Western Blot (WB)
(Western blot analysis of extracts of 293T cells, using KNTC1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human KNTC1 Polyclonal Antibody | anti-KNTC1 antibody
KNTC1 Polyclonal Antibody
Gene Names
KNTC1; ROD
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
KNTC1; Polyclonal Antibody; KNTC1 Polyclonal Antibody; ROD; anti-KNTC1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
IDLIDREQGEDCLLLLKSLPPAEAEKTAERVIIWARLALQEEPDHSKEGKAWRMSVAKTSVDILKILCDIQKDNLQKKDECEEMLKLFKEVASLQENFEVFLSFEDYSNSSLVADLREQHIKAHEVAQAKHKPGSTPEPIAAEVRSPSMESKLHRQALALQMSKQELEAELTLRALKDGNIKTALKKCSDLFKYHCNADTG
Sequence Length
2209
Applicable Applications for anti-KNTC1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human KNTC1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, kinetochore, spindle
Positive Samples
293T
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of 293T cells, using KNTC1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of 293T cells, using KNTC1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-KNTC1 antibody
This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein.
Product Categories/Family for anti-KNTC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 51kDa; 250kDa
Observed: 250kDa
Observed: 250kDa
NCBI Official Full Name
kinetochore-associated protein 1
NCBI Official Synonym Full Names
kinetochore associated 1
NCBI Official Symbol
KNTC1
NCBI Official Synonym Symbols
ROD
NCBI Protein Information
kinetochore-associated protein 1
UniProt Protein Name
Kinetochore-associated protein 1
Protein Family
UniProt Gene Name
KNTC1
UniProt Synonym Gene Names
KIAA0166; HsROD; Rod; hRod
NCBI Description
This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq, Jul 2008]
Uniprot Description
Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores (PubMed:11146660, PubMed:11590237, PubMed:15824131). Its function related to the spindle assembly machinery is proposed to depend on its association in the mitotic RZZ complex.
Research Articles on KNTC1
Similar Products
Product Notes
The KNTC1 kntc1 (Catalog #AAA9133113) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KNTC1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KNTC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the KNTC1 kntc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IDLIDREQGE DCLLLLKSLP PAEAEKTAER VIIWARLALQ EEPDHSKEGK AWRMSVAKTS VDILKILCDI QKDNLQKKDE CEEMLKLFKE VASLQENFEV FLSFEDYSNS SLVADLREQH IKAHEVAQAK HKPGSTPEPI AAEVRSPSME SKLHRQALAL QMSKQELEAE LTLRALKDGN IKTALKKCSD LFKYHCNADT G. It is sometimes possible for the material contained within the vial of "KNTC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
