Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SETD8Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KMT5A Polyclonal Antibody | anti-KMT5A antibody

KMT5A Antibody - middle region

Gene Names
KMT5A; SET8; SET07; SETD8; PR-Set7; PR/SET07
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KMT5A; Polyclonal Antibody; KMT5A Antibody - middle region; anti-KMT5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESG
Sequence Length
393
Applicable Applications for anti-KMT5A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SETD8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SETD8Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SETD8Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KMT5A antibody
The protein encoded by this gene is a protein-lysine N-methyltransferase that can monomethylate Lys-20 of histone H4 to effect transcriptional repression of some genes. The encoded protein is required for cell proliferation and plays a role in chromatin condensation.
Product Categories/Family for anti-KMT5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
N-lysine methyltransferase KMT5A
NCBI Official Synonym Full Names
lysine methyltransferase 5A
NCBI Official Symbol
KMT5A
NCBI Official Synonym Symbols
SET8; SET07; SETD8; PR-Set7; PR/SET07
NCBI Protein Information
N-lysine methyltransferase KMT5A
UniProt Protein Name
N-lysine methyltransferase SETD8
UniProt Gene Name
SETD8
UniProt Synonym Gene Names
KMT5A; PRSET7; SET07; SET8; PR-Set7; PR/SET07
UniProt Entry Name
SETD8_HUMAN

NCBI Description

The protein encoded by this gene is a protein-lysine N-methyltransferase that can monomethylate Lys-20 of histone H4 to effect transcriptional repression of some genes. The encoded protein is required for cell proliferation and plays a role in chromatin condensation. [provided by RefSeq, May 2016]

Uniprot Description

SETD8: a protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Methylates K20 of histone H4 (H4K20me1), a specific tag for epigenetic transcriptional repression. SETD8 protein and H4K20me1 levels are cell cycle regulated, both increasing in S phase and peaking at G2/M phase. Interacts with the PCNA protein, associates with sites of active DNA synthesis and is required for DNA replication and genome stability during S phase. Inhibition of SET8 using shRNA results in arrest of replication forks, induction of double-stranded DNA breaks and a Chk1-mediated cell-cycle arrest in S and G2/M phases of the cell cycle. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNA during mitosis. Involved in chromosome condensation and proper cytokinesis. Inhibition of SET8 using shRNA results in arrest of replication forks, induction of double-stranded DNA breaks and a Chk1-mediated cell-cycle arrest in S and G2/M phases of the cell cycle. Nucleosomes are preferred as substrate compared to free histones. Methylates p53K382, leading to repression of the pro-apoptotic and checkpoint activation functions of p53. SET8 expression levels decrease in response to DNA damage, allowing p53 to activate checkpoints and/or apoptosis. Both the methylation of histone H4K20 and p53K382 appear to be important for the functions of SET8 in S phase. Belongs to the histone-lysine methyltransferase family. PR/SET subfamily. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase, protein lysine; Methyltransferase; EC 2.1.1.43; Amino Acid Metabolism - lysine degradation

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: nucleoplasm; nucleolus; chromosome; nucleus

Molecular Function: protein binding; p53 binding; protein-lysine N-methyltransferase activity; transcription corepressor activity; histone-lysine N-methyltransferase activity

Biological Process: mitosis; transcription, DNA-dependent; cell division; peptidyl-lysine mono-methylation; negative regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; negative regulation of transcription, DNA-dependent; regulation of DNA damage response, signal transduction by p53 class mediator

Research Articles on KMT5A

Similar Products

Product Notes

The KMT5A setd8 (Catalog #AAA3223483) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KMT5A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KMT5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KMT5A setd8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQAPRKKAQG KTQQNRKLTD FYPVRRSSRK SKAELQSEER KRIDELIESG. It is sometimes possible for the material contained within the vial of "KMT5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.