Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KLRA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit KLRA1P Polyclonal Antibody | anti-KLRA1P antibody

KLRA1P Antibody - N-terminal region

Gene Names
KLRA1P; Ly49; KLRA1; LY49L; KLRAP1; Ly-49L
Reactivity
Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLRA1P; Polyclonal Antibody; KLRA1P Antibody - N-terminal region; anti-KLRA1P antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL
Sequence Length
215
Applicable Applications for anti-KLRA1P antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KLRA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KLRA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-KLRA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-KLRA1P antibody
This is a rabbit polyclonal antibody against KLRA1. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-KLRA1P antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Synonym Full Names
killer cell lectin like receptor A1, pseudogene
NCBI Official Symbol
KLRA1P
NCBI Official Synonym Symbols
Ly49; KLRA1; LY49L; KLRAP1; Ly-49L

Research Articles on KLRA1P

Similar Products

Product Notes

The KLRA1P (Catalog #AAA3208315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLRA1P Antibody - N-terminal region reacts with Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLRA1P can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLRA1P for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NDQGEIYSTL RFLQSPSESQ NRLRPDDTQR PGKTDDKEFS VPWHLIAVTL. It is sometimes possible for the material contained within the vial of "KLRA1P, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.