Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using KLKB1 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human KLKB1 Polyclonal Antibody | anti-KLKB1 antibody

KLKB1 Polyclonal Antibody

Gene Names
KLKB1; PKK; PPK; KLK3; PKKD
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
KLKB1; Polyclonal Antibody; KLKB1 Polyclonal Antibody; KLK3; PKK; PKKD; PPK; anti-KLKB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQEN
Sequence Length
638
Applicable Applications for anti-KLKB1 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human KLKB1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using KLKB1 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using KLKB1 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-KLKB1 antibody
This gene encodes a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. The encoded preproprotein present in plasma as a non-covalent complex with high molecular weight kininogen undergoes proteolytic processing mediated by activated coagulation factor XII to generate a disulfide-linked, heterodimeric serine protease comprised of heavy and light chains. Certain mutations in this gene cause prekallikrein deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-KLKB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
plasma kallikrein isoform 1 preproprotein
NCBI Official Synonym Full Names
kallikrein B1
NCBI Official Symbol
KLKB1
NCBI Official Synonym Symbols
PKK; PPK; KLK3; PKKD
NCBI Protein Information
plasma kallikrein
UniProt Protein Name
Plasma kallikrein
Protein Family
UniProt Gene Name
KLKB1
UniProt Synonym Gene Names
KLK3; PKK

NCBI Description

This gene encodes a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. The encoded preproprotein present in plasma as a non-covalent complex with high molecular weight kininogen undergoes proteolytic processing mediated by activated coagulation factor XII to generate a disulfide-linked, heterodimeric serine protease comprised of heavy and light chains. Certain mutations in this gene cause prekallikrein deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

Uniprot Description

The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.

Research Articles on KLKB1

Similar Products

Product Notes

The KLKB1 klkb1 (Catalog #AAA9133365) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLKB1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLKB1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the KLKB1 klkb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GCLTQLYENA FFRGGDVASM YTPNAQYCQM RCTFHPRCLL FSFLPASSIN DMEKRFGCFL KDSVTGTLPK VHRTGAVSGH SLKQCGHQIS ACHRDIYKGV DMRGVNFNVS KVSSVEECQK RCTSNIRCQF FSYATQTFHK AEYRNNCLLK YSPGGTPTAI KVLSNVESGF SLKPCALSEI GCHMNIFQHL AFSDVDVARV LTPDAFVCRT ICTYHPNCLF FTFYTNVWKI ESQRNVCLLK TSESGTPSSS TPQEN. It is sometimes possible for the material contained within the vial of "KLKB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.