Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KIR3DL1 expression in transfected 293T cell line by KIR3DL1 polyclonal antibody. Lane 1: KIR3DL1 transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human KIR3DL1 Polyclonal Antibody | anti-KIR3DL1 antibody

KIR3DL1 (Killer Cell Immunoglobulin-like Receptor 3DL1, CD158 Antigen-like Family Member E, HLA-BW4-specific Inhibitory NK Cell Receptor, MHC Class I NK Cell Receptor, Natural Killer-associated Transcript 3, NKAT-3, p70 Natural Killer Cell Receptor Clones

Gene Names
KIR3DS1; KIR-G1; NKAT10; CD158E2; NKAT-10; KIR-123FM
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KIR3DL1; Polyclonal Antibody; KIR3DL1 (Killer Cell Immunoglobulin-like Receptor 3DL1; CD158 Antigen-like Family Member E; HLA-BW4-specific Inhibitory NK Cell Receptor; MHC Class I NK Cell Receptor; Natural Killer-associated Transcript 3; NKAT-3; p70 Natural Killer Cell Receptor Clones; anti-KIR3DL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KIR3DL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1299
Applicable Applications for anti-KIR3DL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KIR3DL1, aa1-382 (NP_001077008.1).
Immunogen Sequence
MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KIR3DL1 expression in transfected 293T cell line by KIR3DL1 polyclonal antibody. Lane 1: KIR3DL1 transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KIR3DL1 expression in transfected 293T cell line by KIR3DL1 polyclonal antibody. Lane 1: KIR3DL1 transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-KIR3DL1 antibody
Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
Product Categories/Family for anti-KIR3DL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1, mRNA
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, three Ig domains and short cytoplasmic tail 1
NCBI Official Symbol
KIR3DS1
NCBI Official Synonym Symbols
KIR-G1; NKAT10; CD158E2; NKAT-10; KIR-123FM
NCBI Protein Information
killer cell immunoglobulin-like receptor 3DS1

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Research Articles on KIR3DL1

Similar Products

Product Notes

The KIR3DL1 (Catalog #AAA6383620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIR3DL1 (Killer Cell Immunoglobulin-like Receptor 3DL1, CD158 Antigen-like Family Member E, HLA-BW4-specific Inhibitory NK Cell Receptor, MHC Class I NK Cell Receptor, Natural Killer-associated Transcript 3, NKAT-3, p70 Natural Killer Cell Receptor Clones reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIR3DL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIR3DL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIR3DL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.