Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KIF4ASample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KIF4A Polyclonal Antibody | anti-KIF4A antibody

KIF4A Antibody - middle region

Gene Names
KIF4A; KIF4; KIF4G1; MRX100
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIF4A; Polyclonal Antibody; KIF4A Antibody - middle region; anti-KIF4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NDSQLQPIQYQYQDNIKELELEVINLQKEKEELVLELQTAKKDANQAKLS
Sequence Length
1232
Applicable Applications for anti-KIF4A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIF4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KIF4ASample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KIF4ASample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KIF4A antibody
This gene encodes a member of the kinesin 4 subfamily of kinesin related proteins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved in maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135 kDa
NCBI Official Full Name
chromosome-associated kinesin KIF4A
NCBI Official Synonym Full Names
kinesin family member 4A
NCBI Official Symbol
KIF4A
NCBI Official Synonym Symbols
KIF4; KIF4G1; MRX100
NCBI Protein Information
chromosome-associated kinesin KIF4A
UniProt Protein Name
Chromosome-associated kinesin KIF4A
UniProt Gene Name
KIF4A
UniProt Synonym Gene Names
KIF4
UniProt Entry Name
KIF4A_HUMAN

NCBI Description

This gene encodes a member of the kinesin 4 subfamily of kinesin related proteins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved in maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.[provided by RefSeq, Mar 2010]

Uniprot Description

KIF4A: Motor protein that translocates PRC1 to the plus ends of interdigitating spindle microtubules during the metaphase to anaphase transition, an essential step for the formation of an organized central spindle midzone and midbody and for successful cytokinesis. May play a role in mitotic chromosomal positioning and bipolar spindle stabilization. Belongs to the kinesin-like protein family. Chromokinesin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: nucleoplasm; kinesin complex; nuclear matrix; membrane; spindle microtubule; cytoplasm; midbody; chromosome; cytosol

Molecular Function: protein binding; DNA binding; plus-end-directed microtubule motor activity; microtubule binding; ATPase activity; microtubule motor activity; ATP binding

Biological Process: axon guidance; spindle midzone assembly involved in mitosis; cytokinesis after mitosis; metabolic process; organelle organization and biogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class II; anterograde axon cargo transport; blood coagulation; microtubule-based movement

Disease: Mental Retardation, X-linked 100

Research Articles on KIF4A

Similar Products

Product Notes

The KIF4A kif4a (Catalog #AAA3221212) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF4A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIF4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KIF4A kif4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NDSQLQPIQY QYQDNIKELE LEVINLQKEK EELVLELQTA KKDANQAKLS. It is sometimes possible for the material contained within the vial of "KIF4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.