Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-KIF21A Polyclonal Antibody)

Rabbit anti-Human KIF21A Polyclonal Antibody | anti-KIF21A antibody

KIF21A Polyclonal Antibody

Gene Names
KIF21A; FEOM1; CFEOM1; FEOM3A
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
KIF21A; Polyclonal Antibody; KIF21A Polyclonal Antibody; CFEOM1; FEOM1; FEOM3A; kinesin family member 21A; anti-KIF21A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.39 mg/ml (varies by lot)
Sequence Length
1674
Applicable Applications for anti-KIF21A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1070-1270 of human KIF21A (NP_001166935.1).
Immunogen Sequence
KQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSLSEKKIPEPSPVTRRKAYEKAEKSKAKEQKHSDSGTSEASL
Positive Samples
U-87MG, LO2, HeLa
Cellular Location
Cytoplasm, Cytoskeleton
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-KIF21A Polyclonal Antibody)

Western Blot (WB) (Western blot-KIF21A Polyclonal Antibody)
Related Product Information for anti-KIF21A antibody
This gene encodes a member of the KIF4 subfamily of kinesin-like motor proteins. The encoded protein is characterized by an N-terminal motor domain a coiled-coil stalk domain and a C-terminal WD-40 repeat domain. This protein may be involved in microtubule dependent transport. Mutations in this gene are the cause of congenital fibrosis of extraocular muscles-1. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 180kDa; 182kDa; 185kDa; 187kDa
Observed: 187kDa
NCBI Official Full Name
kinesin-like protein KIF21A isoform 1
NCBI Official Synonym Full Names
kinesin family member 21A
NCBI Official Symbol
KIF21A
NCBI Official Synonym Symbols
FEOM1; CFEOM1; FEOM3A
NCBI Protein Information
kinesin-like protein KIF21A
UniProt Protein Name
Kinesin-like protein KIF21A
Protein Family
UniProt Gene Name
KIF21A
UniProt Synonym Gene Names
KIAA1708; KIF2
UniProt Entry Name
KI21A_HUMAN

NCBI Description

This gene encodes a member of the KIF4 subfamily of kinesin-like motor proteins. The encoded protein is characterized by an N-terminal motor domain a coiled-coil stalk domain and a C-terminal WD-40 repeat domain. This protein may be involved in microtubule dependent transport. Mutations in this gene are the cause of congenital fibrosis of extraocular muscles-1. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2010]

Uniprot Description

KIF21A: Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity. Defects in KIF21A are a cause of congenital fibrosis of extraocular muscles type 1 (CFEOM1). CFEOM encompasses several different inherited strabismus syndromes characterized by congenital restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. CFEOM is characterized clinically by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. CFEOM1 individuals show an absence of the superior division of the oculomotor nerve (cranial nerve III) and corresponding oculomotor subnuclei. Belongs to the kinesin-like protein family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Microtubule-binding; Motor

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: microtubule; kinesin complex; cytoplasm

Molecular Function: protein binding; microtubule binding; ATPase activity; microtubule motor activity; ATP binding

Biological Process: metabolic process; microtubule-based movement

Disease: Fibrosis Of Extraocular Muscles, Congenital, 1

Research Articles on KIF21A

Similar Products

Product Notes

The KIF21A kif21a (Catalog #AAA9140906) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF21A Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIF21A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the KIF21A kif21a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIF21A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.