Western Blot (WB)
(Anti- KIAA0652 Picoband antibody, MBS177841, Western blottingAll lanes: Anti KIAA0652 (MBS177841) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: HEPA Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 56KD )
anti-Human, Mouse KIAA0652 Polyclonal Antibody | anti-KIAA0652 antibody
Anti-KIAA0652 Antibody
Gene Names
ATG13; KIAA0652; PARATARG8
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
KIAA0652; Polyclonal Antibody; Anti-KIAA0652 Antibody; Autophagy-related protein 13; ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); ATG13_HUMAN; Autophagy related 13; Autophagy related protein 13; FLJ20698; OTTHUMP00000233321; OTTHUMP00000233322; OTTHUMP00000233323; OTTHUMP00000233324; OTTHUMP00000233325; OTTHUMP00000233326; autophagy related 13; anti-KIAA0652 antibody
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
517
Applicable Applications for anti-KIAA0652 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- KIAA0652 Picoband antibody, MBS177841, Western blottingAll lanes: Anti KIAA0652 (MBS177841) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: HEPA Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 56KD )
Western Blot (WB)
(Anti- KIAA0652 Picoband antibody, MBS177841, Western blottingAll lanes: Anti KIAA0652 (MBS177841) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: HEPA Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 56KD )
Related Product Information for anti-KIAA0652 antibody
Description: Rabbit IgG polyclonal antibody for Autophagy-related protein 13(ATG13) detection. Tested with WB in Human;Mouse.
Background: Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Background: Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
References
1. "Entrez Gene: KIAA0652". 2. Chan EY, Longatti A, McKnight NC, Tooze SA (January 2009)."Kinase-Inactivated ULK Proteins Inhibit Autophagy via Their Conserved C-Terminal Domains Using an Atg13-Independent Mechanism". Mol. Cell. Biol. 29 (1): 157-71. 3. Hosokawa N, Hara T, Kaizuka T, Kishi C, Takamura A, Miura Y, Iemura S, Natsume T, Takehana K, Yamada N, Guan JL, Oshiro N, Mizushima N (April 2009). "Nutrient-dependent mTORC1 Association with the ULK1-Atg13-FIP200 Complex Required for Autophagy". Mol. Biol. Cell 20 (7): 1981-91. 4. Mercer CA, Kaliappan A, Dennis PB (July 2009). "A novel, human Atg13 binding protein, Atg101, interacts with ULK1 and is essential for macroautophagy". Autophagy 5 (5): 649-62.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,155 Da
NCBI Official Full Name
autophagy-related protein 13 isoform 1
NCBI Official Synonym Full Names
autophagy related 13
NCBI Official Symbol
ATG13
NCBI Official Synonym Symbols
KIAA0652; PARATARG8
NCBI Protein Information
autophagy-related protein 13
UniProt Protein Name
Autophagy-related protein 13
UniProt Gene Name
ATG13
UniProt Synonym Gene Names
KIAA0652
UniProt Entry Name
ATG13_HUMAN
Uniprot Description
ATG13: an autophagy factor required for autophagosome formation. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Under starvation conditions, is localized to puncate structures primarily representing the isolation membrane; the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome formation. Phosphorylated by ULK1 and ULK2. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin. Part of a complex consisting of ATG13, ULK1 and RB1CC1. Interacts with ATG101. Interacts with ULK1 and -2 via C-terminus. Three isoforms of the human protein are produced by alternative splicing.
Protein type: Autophagy; Vesicle
Chromosomal Location of Human Ortholog: 11p11.2
Cellular Component: cytosol; mitochondrion
Molecular Function: protein binding; protein kinase binding
Biological Process: autophagic vacuole formation; macroautophagy
Research Articles on KIAA0652
Similar Products
Product Notes
The KIAA0652 atg13 (Catalog #AAA177841) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-KIAA0652 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KIAA0652 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the KIAA0652 atg13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA0652, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
