Western Blot (WB)
(KRT7 rabbit polyclonal antibody. Western Blot analysis of KRT7 expression in HeLa.)
Rabbit anti-Human Keratin 7 Polyclonal Antibody | anti-KRT7 antibody
Keratin 7 (Keratin Type II Cytoskeletal 7, Keratin-7, K7, KRT7, Cytokeratin-7, CK7, CK-7, K2C7, MGC3625, MGC129731, Sarcolectin, SCL, Type-II Keratin Kb7) APC
Gene Names
KRT7; K7; CK7; SCL; K2C7
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Keratin 7; Polyclonal Antibody; Keratin 7 (Keratin Type II Cytoskeletal 7; Keratin-7; K7; KRT7; Cytokeratin-7; CK7; CK-7; K2C7; MGC3625; MGC129731; Sarcolectin; SCL; Type-II Keratin Kb7) APC; anti-KRT7 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KRT7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1668
Applicable Applications for anti-KRT7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KRT7, aa1-469 (AAH02700.1).
Immunogen Sequence
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(KRT7 rabbit polyclonal antibody. Western Blot analysis of KRT7 expression in HeLa.)
Western Blot (WB)
(KRT7 rabbit polyclonal antibody. Western Blot analysis of KRT7 expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of KRT7 expression in transfected 293T cell line by KRT7 polyclonal antibody. Lane 1: KRT7 transfected lysate (51.4kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of KRT7 expression in transfected 293T cell line by KRT7 polyclonal antibody. Lane 1: KRT7 transfected lysate (51.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-KRT7 antibody
Cytokeratin 7 was found to occur in the columnar and glandular epithelium of the lung, cervix, breast, bile ducts, larger collecting ducts of the kidney and in mesothelium, but is absent from gastrointestinal epithelium, hepatocytes and myoepithelium. Several types of adenocarcinomas of the gastrointestinal tract and of the urinary tract are negative, while adenocarcinomas of the mammary gland, ovary and lung are positive.
Product Categories/Family for anti-KRT7 antibody
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]
Research Articles on KRT7
Similar Products
Product Notes
The KRT7 (Catalog #AAA6383488) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Keratin 7 (Keratin Type II Cytoskeletal 7, Keratin-7, K7, KRT7, Cytokeratin-7, CK7, CK-7, K2C7, MGC3625, MGC129731, Sarcolectin, SCL, Type-II Keratin Kb7) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Keratin 7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KRT7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Keratin 7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
