Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit KDM5C Polyclonal Antibody | anti-KDM5C antibody

KDM5C Rabbit pAb

Gene Names
KDM5C; MRXJ; SMCX; MRX13; MRXSJ; XE169; MRXSCJ; JARID1C; DXS1272E
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
KDM5C; Polyclonal Antibody; KDM5C Rabbit pAb; DXS1272E; JARID1C; MRX13; MRXJ; MRXSCJ; MRXSJ; SMCX; XE169; anti-KDM5C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
Applicable Applications for anti-KDM5C antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human KDM5C (XP_011529128.1).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-KDM5C antibody
Background: This gene is a member of the SMCY homolog family and encodes a protein with one ARID domain, one JmjC domain, one JmjN domain and two PHD-type zinc fingers. The DNA-binding motifs suggest this protein is involved in the regulation of transcription and chromatin remodeling. Mutations in this gene have been associated with X-linked mental retardation. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
1560
NCBI Official Full Name
Lysine-specific demethylase 5C
NCBI Official Synonym Full Names
lysine (K)-specific demethylase 5C
NCBI Official Symbol
KDM5C
NCBI Official Synonym Symbols
MRXJ; SMCX; MRX13; MRXSJ; XE169; MRXSCJ; JARID1C; DXS1272E
NCBI Protein Information
lysine-specific demethylase 5C; Smcy homolog, X-linked; Smcx homolog, X chromosome; histone demethylase JARID1C; JmjC domain-containing protein SMCX; Jumonji/ARID domain-containing protein 1C; Jumonji, AT rich interactive domain 1C (RBP2-like)
UniProt Protein Name
Lysine-specific demethylase 5C
UniProt Gene Name
KDM5C
UniProt Synonym Gene Names
DXS1272E; JARID1C; SMCX; XE169
UniProt Entry Name
KDM5C_HUMAN

NCBI Description

This gene is a member of the SMCY homolog family and encodes a protein with one ARID domain, one JmjC domain, one JmjN domain and two PHD-type zinc fingers. The DNA-binding motifs suggest this protein is involved in the regulation of transcription and chromatin remodeling. Mutations in this gene have been associated with X-linked mental retardation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]

Uniprot Description

JARID1C: Histone demethylase that specifically demethylates 'Lys- 4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. Part of two distinct complexes, one containing E2F6, and the other containing REST. Expressed in all tissues examined. Highest levels found in brain and skeletal muscle. Belongs to the JARID1 histone demethylase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.14.11.-; Oxidoreductase; Demethylase

Chromosomal Location of Human Ortholog: Xp11.22-p11.21

Cellular Component: nucleoplasm; nucleus

Molecular Function: histone demethylase activity (H3-K4 specific); DNA binding; zinc ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; rhythmic process; negative regulation of transcription, DNA-dependent

Disease: Mental Retardation, X-linked, Syndromic, Claes-jensen Type

Research Articles on KDM5C

Similar Products

Product Notes

The KDM5C kdm5c (Catalog #AAA9142102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDM5C Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KDM5C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the KDM5C kdm5c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ERHGSRARGR ALERRRRRKV DRGGEGDDPA REELEPKRVR SSGPEAEEVQ EEEELEEETG GEGPPAPIPT TGSPSTQENQ NGLEPAEGTT SGPSAPFSTL TPRLHLPCPQ QPPQQQL. It is sometimes possible for the material contained within the vial of "KDM5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.