Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNMB4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit KCNMB4 Polyclonal Antibody | anti-KCNMB4 antibody

KCNMB4 antibody - middle region

Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNMB4; Polyclonal Antibody; KCNMB4 antibody - middle region; anti-KCNMB4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
Sequence Length
210
Applicable Applications for anti-KCNMB4 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNMB4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-KCNMB4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-KCNMB4 antibody
This is a rabbit polyclonal antibody against KCNMB4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit.
Product Categories/Family for anti-KCNMB4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
calcium-activated potassium channel subunit beta-4
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily M regulatory beta subunit 4
NCBI Official Symbol
KCNMB4
NCBI Protein Information
calcium-activated potassium channel subunit beta-4
UniProt Protein Name
Calcium-activated potassium channel subunit beta-4
UniProt Gene Name
KCNMB4
UniProt Synonym Gene Names
BKbeta4; Hbeta4
UniProt Entry Name
KCMB4_HUMAN

NCBI Description

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNMB4: Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations. Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB4 subfamily.

Protein type: Membrane protein, multi-pass; Channel, potassium; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q

Cellular Component: integral to plasma membrane; plasma membrane; voltage-gated potassium channel complex

Molecular Function: calcium-activated potassium channel activity; potassium channel regulator activity; protein binding

Biological Process: blood coagulation; detection of calcium ion; generation of action potential; potassium ion transport; regulation of action potential; regulation of neurotransmitter secretion; regulation of vasoconstriction; synaptic transmission

Research Articles on KCNMB4

Similar Products

Product Notes

The KCNMB4 kcnmb4 (Catalog #AAA3202489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNMB4 antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's KCNMB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNMB4 kcnmb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TCGADCRGTS QYPCVQVYVN NSESNSRALL HSDEHQLLTN PKCSYIPPCK. It is sometimes possible for the material contained within the vial of "KCNMB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.