Rabbit KCNIP1 Polyclonal Antibody | anti-KCNIP1 antibody

KCNIP1 antibody - N-terminal region

Cat. Num. AAA3202493

• Gene Names: KCNIP1; VABP; KCHIP1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: KCNIP1; Polyclonal Antibody; KCNIP1 antibody - N-terminal region; anti-KCNIP1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY
• Sequence Length: 216

• Applicable Applications for anti-KCNIP1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Brain )

Western Blot (WB)

(WB Suggested Anti-KCNIP1 Antibody Titration: 1.35ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Related Product Information for anti-KCNIP1 antibody

This is a rabbit polyclonal antibody against KCNIP1. It was validated on Western Blot and immunohistochemistry

Target Description: KCNIP1 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

Product Categories/Family for anti-KCNIP1 antibody

Polyclonal; Transcription Factor; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 7657247
• NCBI GeneID: 30820
• NCBI Accession #: NP_055407
• NCBI GenBank Nucleotide #: NM_014592
• UniProt Accession #: Q9NZI2
• Molecular Weight: 25kDa
• NCBI Official Full Name: Kv channel-interacting protein 1 isoform 2
• NCBI Official Synonym Full Names: potassium voltage-gated channel interacting protein 1
• NCBI Official Symbol: KCNIP1
• NCBI Official Synonym Symbols: VABP; KCHIP1
• NCBI Protein Information: Kv channel-interacting protein 1
• UniProt Protein Name: Kv channel-interacting protein 1
• Protein Family: Kv channel-interacting protein
• UniProt Gene Name: KCNIP1
• UniProt Synonym Gene Names: KCHIP1; VABP; KChIP1
• UniProt Entry Name: KCIP1_HUMAN

NCBI Description

This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

KCNIP1: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface. Belongs to the recoverin family. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: voltage-gated potassium channel complex; extrinsic to internal side of plasma membrane; cell soma; cytoplasm; dendrite

Molecular Function: protein binding; potassium channel regulator activity; potassium channel activity; protein heterodimerization activity; protein N-terminus binding; voltage-gated ion channel activity; calcium ion binding

Biological Process: positive regulation of action potential