Western Blot (WB)
(Western blot analysis of extracts of mouse brain, using KCNH7 antibody at 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Rabbit anti-Mouse KCNH7 Polyclonal Antibody | anti-KCNH7 antibody
KCNH7 Rabbit pAb
Gene Names
KCNH7; ERG3; HERG3; Kv11.3
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
KCNH7; Polyclonal Antibody; KCNH7 Rabbit pAb; ERG3; HERG3; Kv11.3; anti-KCNH7 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HKNGSTFICNTHIIPVKNQEGVAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKT
Applicable Applications for anti-KCNH7 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human KCNH7 (NP_775185.1).
Cellular Location
Membrane, Multi-pass membrane protein
Positive Samples
Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of mouse brain, using KCNH7 antibody at 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of mouse brain, using KCNH7 antibody at 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-KCNH7 antibody
Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. There are at least two alternatively spliced transcript variants derived from this gene and encoding distinct isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,904 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily H member 7 isoform 1
NCBI Official Synonym Full Names
potassium channel, voltage gated eag related subfamily H, member 7
NCBI Official Symbol
KCNH7
NCBI Official Synonym Symbols
ERG3; HERG3; Kv11.3
NCBI Protein Information
potassium voltage-gated channel subfamily H member 7; ERG-3; eag-related protein 3; ether-a-go-go-related gene potassium channel 3; ether-a-go-go-related protein 3; potassium channel subunit HERG-3; voltage-gated potassium channel subunit Kv11.3
UniProt Protein Name
Potassium voltage-gated channel subfamily H member 7
Protein Family
UniProt Gene Name
KCNH7
UniProt Synonym Gene Names
ERG3; ERG-3; Eag-related protein 3; Ether-a-go-go-related protein 3; hERG-3
UniProt Entry Name
KCNH7_HUMAN
Similar Products
Product Notes
The KCNH7 kcnh7 (Catalog #AAA9142128) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNH7 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCNH7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the KCNH7 kcnh7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HKNGSTFICN THIIPVKNQE GVAMMFIINF EYVTDNENAA TPERVNPILP IKTVNRKFFG FKFPGLRVLT YRKQSLPQED PDVVVIDSSK HSDDSVAMKH FKSPTKESCS PSEADDTKAL IQPSKCSPLV NISGPLDHSS PKRQWDRLYP DMLQSSSQLS HSRSRESLCS IRRASSVHDI EGFGVHPKNI FRDRHASEGP FNHIKSSLLG STSDSNLNKY STINKIPQLT LNFSEVKTEK KNSSPPSSDK T. It is sometimes possible for the material contained within the vial of "KCNH7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
