Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Rabbit anti-Human, Rat KCNH6 Polyclonal Antibody | anti-KCNH6 antibody

KCNH6 antibody - middle region

Gene Names
KCNH6; ERG2; ERG-2; HERG2; Kv11.2; hERG-2
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNH6; Polyclonal Antibody; KCNH6 antibody - middle region; anti-KCNH6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS
Sequence Length
905
Applicable Applications for anti-KCNH6 antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNH6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-KCNH6 antibody
This is a rabbit polyclonal antibody against KCNH6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily H member 6 isoform 2
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily H member 6
NCBI Official Symbol
KCNH6
NCBI Official Synonym Symbols
ERG2; ERG-2; HERG2; Kv11.2; hERG-2
NCBI Protein Information
potassium voltage-gated channel subfamily H member 6
UniProt Protein Name
Potassium voltage-gated channel subfamily H member 6
UniProt Gene Name
KCNH6
UniProt Synonym Gene Names
ERG2; ERG-2; Eag-related protein 2; Ether-a-go-go-related protein 2; hERG-2; hERG2

NCBI Description

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

Kv11.2: Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, rectifying current. Channel properties may be modulated by cAMP and subunit assembly. Belongs to the potassium channel family. H (Eag) (TC 1.A.1.20) subfamily. Kv11.2/KCNH6 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, potassium; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: integral component of plasma membrane; plasma membrane

Molecular Function: voltage-gated potassium channel activity

Biological Process: regulation of membrane potential

Research Articles on KCNH6

Similar Products

Product Notes

The KCNH6 kcnh6 (Catalog #AAA3202548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNH6 antibody - middle region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNH6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNH6 kcnh6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRMPHLAVAT DKTLAPSSEQ EQPEGLWPPL ASPLHPLEVQ GLICGPCFSS. It is sometimes possible for the material contained within the vial of "KCNH6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.