Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNH3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysate)

Rabbit KCNH3 Polyclonal Antibody | anti-KCNH3 antibody

KCNH3 antibody - middle region

Gene Names
KCNH3; BEC1; ELK2; Kv12.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNH3; Polyclonal Antibody; KCNH3 antibody - middle region; anti-KCNH3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLL
Sequence Length
1083
Applicable Applications for anti-KCNH3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNH3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNH3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-KCNH3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-KCNH3 antibody
This is a rabbit polyclonal antibody against KCNH3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact function of this protein remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily H member 3 isoform 1
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily H member 3
NCBI Official Symbol
KCNH3
NCBI Official Synonym Symbols
BEC1; ELK2; Kv12.2
NCBI Protein Information
potassium voltage-gated channel subfamily H member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily H member 3
UniProt Gene Name
KCNH3
UniProt Synonym Gene Names
KIAA1282; BEC1; ELK channel 2; ELK2
UniProt Entry Name
KCNH3_HUMAN

NCBI Description

The protein encoded by this gene is a voltage-gated potassium channel alpha subunit predominantly expressed in the forebrain. Studies in mice have found that cognitive function increases when this gene is knocked out. In humans, the encoded protein has been shown to be capable of binding glycoprotein 120 of the human immunodeficiency virus type 1 (HIV-1) envelope. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

Kv12.2: Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly. Belongs to the potassium channel family. H (Eag) (TC 1.A.1.20) subfamily. Kv12.2/KCNH3 sub-subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: protein binding; voltage-gated potassium channel activity; two-component sensor activity

Biological Process: synaptic transmission; regulation of membrane potential; two-component signal transduction system (phosphorelay); potassium ion transport

Research Articles on KCNH3

Similar Products

Product Notes

The KCNH3 kcnh3 (Catalog #AAA3202479) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNH3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNH3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNH3 kcnh3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGDNTLMSTL EEKETDGEQG PTVSPAPADE PSSPLLSPGC TSSSSAAKLL. It is sometimes possible for the material contained within the vial of "KCNH3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.