Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- KCNA3 Picoband antibody, MBS177763, Western blottingAll lanes: Anti KCNA3 (MBS177763) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 64KDObserved bind size: 55KD )

KCNA3 Polyclonal Antibody | anti-KCNA3 antibody

Anti-KCNA3 Antibody

Gene Names
KCNA3; MK3; HGK5; HLK3; PCN3; HPCN3; KV1.3; HUKIII
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
KCNA3; Polyclonal Antibody; Anti-KCNA3 Antibody; Potassium voltage-gated channel subfamily A member 3; HGK 5; HGK5; HLK 3; HLK3; HPCN 3; HPCN3; HuKIII; KCNA 3; Kcna3; KCNA3_HUMAN; KV1.3; MK 3; MK3; OTTHUMP00000032397; PCN 3; PCN3; Potassium channel 3; Potassium voltage gated channel shaker related subfamily member 3; Potassium voltage gated channel subfamily A member 3; Type n potassium channel; Voltage gated potassium channel protein Kv1.3; Voltage gated potassium channel subunit Kv1.3; Voltage-gated K(+) channel HuKIII; Voltage-gated potassium channel subunit Kv1.3; potassium channel; voltage gated shaker related subfamily A; member 3; anti-KCNA3 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
575
Applicable Applications for anti-KCNA3 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- KCNA3 Picoband antibody, MBS177763, Western blottingAll lanes: Anti KCNA3 (MBS177763) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 64KDObserved bind size: 55KD )

Western Blot (WB) (Anti- KCNA3 Picoband antibody, MBS177763, Western blottingAll lanes: Anti KCNA3 (MBS177763) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 64KDObserved bind size: 55KD )
Related Product Information for anti-KCNA3 antibody
Description: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human;Mouse;Rat.

Background: Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.
References
1. Szabó I, Bock J, Grassmé H, Soddemann M, Wilker B, Lang F, Zoratti M, Gulbins E (September 2008). "Mitochondrial potassium channel Kv1.3 mediates Bax-induced apoptosis in lymphocytes". Proc. Natl. Acad. Sci. U.S.A. 105 (39): 14861-6. 2. Storey NM, Gómez-Angelats M, Bortner CD, Armstrong DL, Cidlowski JA (August 2003). "Stimulation of Kv1.3 potassium channels by death receptors during apoptosis in Jurkat T lymphocytes". J. Biol. Chem. 278 (35): 33319-26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,842 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 3
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A member 3
NCBI Official Symbol
KCNA3
NCBI Official Synonym Symbols
MK3; HGK5; HLK3; PCN3; HPCN3; KV1.3; HUKIII
NCBI Protein Information
potassium voltage-gated channel subfamily A member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 3
UniProt Gene Name
KCNA3
UniProt Synonym Gene Names
HGK5
UniProt Entry Name
KCNA3_HUMAN

NCBI Description

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

Kv1.3: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.3/KCNA3 sub-subfamily.

Protein type: Channel, potassium; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: axon; lipid raft; plasma membrane; voltage-gated potassium channel complex

Molecular Function: delayed rectifier potassium channel activity; outward rectifier potassium channel activity; voltage-gated ion channel activity

Biological Process: potassium ion transport; protein homooligomerization

Research Articles on KCNA3

Similar Products

Product Notes

The KCNA3 kcna3 (Catalog #AAA177763) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-KCNA3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the KCNA3 kcna3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.