Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KATNB1Sample Tissue: Human MDA-MB-435s lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KATNB1 Polyclonal Antibody | anti-KATNB1 antibody

KATNB1 Antibody - middle region

Gene Names
KATNB1; KAT; LIS6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KATNB1; Polyclonal Antibody; KATNB1 Antibody - middle region; anti-KATNB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: RVKQNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPR
Sequence Length
655
Applicable Applications for anti-KATNB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KATNB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KATNB1Sample Tissue: Human MDA-MB-435s lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KATNB1Sample Tissue: Human MDA-MB-435s lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KATNB1 antibody
Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family of ATPases.
Product Categories/Family for anti-KATNB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72 kDa
NCBI Official Full Name
katanin p80 WD40 repeat-containing subunit B1
NCBI Official Synonym Full Names
katanin regulatory subunit B1
NCBI Official Symbol
KATNB1
NCBI Official Synonym Symbols
KAT; LIS6
NCBI Protein Information
katanin p80 WD40 repeat-containing subunit B1
UniProt Protein Name
Katanin p80 WD40 repeat-containing subunit B1
Protein Family
UniProt Gene Name
KATNB1
UniProt Synonym Gene Names
Katanin p80 subunit B1
UniProt Entry Name
KTNB1_HUMAN

NCBI Description

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family of ATPases. [provided by RefSeq, Jul 2008]

Uniprot Description

KATNB1: Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth. Belongs to the WD repeat KATNB1 family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: microtubule cytoskeleton; spindle pole; microtubule; centrosome; growth cone; cell soma; membrane; axon; katanin complex; cytoplasm; plasma membrane; midbody; nucleus

Molecular Function: dynein binding; protein heterodimerization activity; microtubule binding; microtubule-severing ATPase activity

Biological Process: positive regulation of microtubule depolymerization; cell division; negative regulation of microtubule depolymerization; metabolic process; microtubule severing; mitotic chromosome movement towards spindle pole; protein targeting

Disease: Lissencephaly 6, With Microcephaly

Research Articles on KATNB1

Similar Products

Product Notes

The KATNB1 katnb1 (Catalog #AAA3220804) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KATNB1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KATNB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KATNB1 katnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVKQNSESER RSPSSEDDRD ERESRAEIQN AEDYNEIFQP KNSISRTPPR. It is sometimes possible for the material contained within the vial of "KATNB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.