Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KAT8Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human KAT8 Polyclonal Antibody | anti-KAT8 antibody

KAT8 Antibody - N-terminal region

Gene Names
KAT8; MOF; hMOF; MYST1; ZC2HC8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KAT8; Polyclonal Antibody; KAT8 Antibody - N-terminal region; anti-KAT8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKI
Sequence Length
458
Applicable Applications for anti-KAT8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KAT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KAT8Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KAT8Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KAT8 antibody
This is a rabbit polyclonal antibody against KAT8. It was validated on Western Blot

Target Description: This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-KAT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
Histone acetyltransferase KAT8
NCBI Official Synonym Full Names
lysine acetyltransferase 8
NCBI Official Symbol
KAT8
NCBI Official Synonym Symbols
MOF; hMOF; MYST1; ZC2HC8
NCBI Protein Information
histone acetyltransferase KAT8
UniProt Protein Name
Histone acetyltransferase KAT8
UniProt Gene Name
KAT8
UniProt Synonym Gene Names
MOF; MYST1; MYST-1; hMOF
UniProt Entry Name
KAT8_HUMAN

NCBI Description

This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

MYST1: Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. As part of the MSL complex it is involved in acetylation of nucleosomal histone H4 producing specifically H4K16ac. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. That activity is less specific than the one of the MSL complex. Belongs to the MYST (SAS/MOZ) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.3.1.48; Acetyltransferase

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: kinetochore; nucleoplasm; nuclear membrane; nucleus; histone acetyltransferase complex

Molecular Function: protein binding; histone acetyltransferase activity; enzyme binding; metal ion binding; acetyltransferase activity; histone acetyltransferase activity (H4-K16 specific); transcription factor binding; methylated histone residue binding

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; myeloid cell differentiation; regulation of autophagy; histone acetylation; negative regulation of transcription, DNA-dependent

Research Articles on KAT8

Similar Products

Product Notes

The KAT8 kat8 (Catalog #AAA3220131) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KAT8 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KAT8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KAT8 kat8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPERKITRNQ KRKHDEINHV QKTYAEMDPT TAALEKEHEA ITKVKYVDKI. It is sometimes possible for the material contained within the vial of "KAT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.