Western Blot (WB)
(KAP11.1 antibody (MBS5301698) used at 1 ug/ml to detect target protein.)
Rabbit KAP11.1 Polyclonal Antibody | anti-KAP11.1 antibody
KAP11.1 antibody
Gene Names
KRTAP11-1; HACL1; HACL-1; KAP11.1
Applications
Western Blot
Purity
Affinity purified
Synonyms
KAP11.1; Polyclonal Antibody; KAP11.1 antibody; Polyclonal KAP11.1; Anti-KAP11.1; KAP-11.1; KRTAP11-1; KAP 11.1; Keratin Associated Protein 11-1; anti-KAP11.1 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
KAP11.1 antibody was raised against the N terminal of KRTAP11-1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRTAP11-1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
163
Applicable Applications for anti-KAP11.1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
KRTAP11-1 belongs to the PMG family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Cross-Reactivity
Human
Immunogen
KAP11.1 antibody was raised using the N terminal of KRTAP11-1 corresponding to a region with amino acids SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(KAP11.1 antibody (MBS5301698) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(KAP11.1 antibody (MBS5301698) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KAP11.1 antibody
Rabbit polyclonal KAP11.1 antibody raised against the N terminal of KRTAP11-1
Product Categories/Family for anti-KAP11.1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17 kDa (MW of target protein)
NCBI Official Full Name
keratin-associated protein 11-1
NCBI Official Synonym Full Names
keratin associated protein 11-1
NCBI Official Symbol
KRTAP11-1
NCBI Official Synonym Symbols
HACL1; HACL-1; KAP11.1
NCBI Protein Information
keratin-associated protein 11-1
UniProt Protein Name
Keratin-associated protein 11-1
UniProt Gene Name
KRTAP11-1
UniProt Synonym Gene Names
KAP11.1; KRTAP11.1
UniProt Entry Name
KR111_HUMAN
Uniprot Description
KRTAP11-1: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high- sulfur and high-glycine-tyrosine keratins. Belongs to the PMG family.
Chromosomal Location of Human Ortholog: 21q22.1
Cellular Component: keratin filament
Molecular Function: structural molecule activity
Research Articles on KAP11.1
Similar Products
Product Notes
The KAP11.1 krtap11-1 (Catalog #AAA5301698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KAP11.1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KAP11.1 krtap11-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KAP11.1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
