Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of JAZF1 expression in transfected 293T cell line by JAZF1 polyclonal antibody. Lane 1: JAZF1 transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human JAZF1 Polyclonal Antibody | anti-JAZF1 antibody

JAZF1 (TIP27, ZNF802, Juxtaposed with Another Zinc Finger Protein 1, TAK1-interacting Protein 27, Zinc Finger Protein 802, DKFZp761K2222)

Gene Names
JAZF1; TIP27; ZNF802
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
JAZF1; Polyclonal Antibody; JAZF1 (TIP27; ZNF802; Juxtaposed with Another Zinc Finger Protein 1; TAK1-interacting Protein 27; Zinc Finger Protein 802; DKFZp761K2222); Anti -JAZF1 (TIP27; anti-JAZF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human JAZF1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
Applicable Applications for anti-JAZF1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human JAZF1, aa1-243 (AAH42441.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of JAZF1 expression in transfected 293T cell line by JAZF1 polyclonal antibody. Lane 1: JAZF1 transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of JAZF1 expression in transfected 293T cell line by JAZF1 polyclonal antibody. Lane 1: JAZF1 transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-JAZF1 antibody
This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized
Product Categories/Family for anti-JAZF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,079 Da
NCBI Official Full Name
juxtaposed with another zinc finger protein 1
NCBI Official Synonym Full Names
JAZF zinc finger 1
NCBI Official Symbol
JAZF1
NCBI Official Synonym Symbols
TIP27; ZNF802
NCBI Protein Information
juxtaposed with another zinc finger protein 1; zinc finger protein 802; TAK1-interacting protein 27; juxtaposed with another zinc finger gene 1
UniProt Protein Name
Juxtaposed with another zinc finger protein 1
UniProt Gene Name
JAZF1
UniProt Synonym Gene Names
TIP27; ZNF802
UniProt Entry Name
JAZF1_HUMAN

NCBI Description

This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized [provided by RefSeq, Jul 2008]

Uniprot Description

JAZF1: Potential transcription factor. A chromosomal aberration involving JAZF1 may be a cause of endometrial stromal tumors. Translocation t(7;17)(p15;q21) with SUZ12. The translocation generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; C2H2-type zinc finger protein; Transcription, coactivator/corepressor; Oncoprotein

Chromosomal Location of Human Ortholog: 7p15.2-p15.1

Cellular Component: transcriptional repressor complex; nucleus

Molecular Function: nucleic acid binding; metal ion binding; transcription corepressor activity

Biological Process: transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on JAZF1

Similar Products

Product Notes

The JAZF1 jazf1 (Catalog #AAA643832) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The JAZF1 (TIP27, ZNF802, Juxtaposed with Another Zinc Finger Protein 1, TAK1-interacting Protein 27, Zinc Finger Protein 802, DKFZp761K2222) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's JAZF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the JAZF1 jazf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTGIAAASFF SNTCRFGGCG LHFPTLADLI EHIEDNHIDT DPRVLEKQEL QQPTYVALSY INRFMTDAAR REQESLKKKI QPKLSLTLSS SVSRGNVSTP PRHSSGSLTP PVTPPITPSS SFRSSTPTGS EYGEEEVDYE ESDSDESWTT ESAISSEAIL SSMCMNGGEE KPFACPVPGC KKRYKNVNGI KYHAKNGHRT QIRVRKPFKC RCGKSYKTAQ GLRHHTINFH PPVSAEIIRK MQQ. It is sometimes possible for the material contained within the vial of "JAZF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.