Rabbit anti-Human JAZF1 Polyclonal Antibody | anti-JAZF1 antibody

JAZF1 (TIP27, ZNF802, Juxtaposed with Another Zinc Finger Protein 1, TAK1-interacting Protein 27, Zinc Finger Protein 802, DKFZp761K2222) (Biotin)

Cat. Num. AAA6383368

• Gene Names: JAZF1; TIP27; ZNF802
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: JAZF1; Polyclonal Antibody; JAZF1 (TIP27; ZNF802; Juxtaposed with Another Zinc Finger Protein 1; TAK1-interacting Protein 27; Zinc Finger Protein 802; DKFZp761K2222) (Biotin); anti-JAZF1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human JAZF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 3058

• Applicable Applications for anti-JAZF1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human JAZF, aa1-243 (AAH42441.1).
• Immunogen Sequence: MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(JAZF1 rabbit polyclonal antibody. Western Blot analysis of JAZF1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of JAZF1 expression in transfected 293T cell line by JAZF1 polyclonal antibody. Lane 1: JAZF1 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-JAZF1 antibody

This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized

Product Categories/Family for anti-JAZF1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 27769230
• NCBI GeneID: 221895
• NCBI Official Full Name: Homo sapiens JAZF zinc finger 1, mRNA
• NCBI Official Synonym Full Names: JAZF zinc finger 1
• NCBI Official Symbol: JAZF1
• NCBI Official Synonym Symbols: TIP27; ZNF802
• NCBI Protein Information: juxtaposed with another zinc finger protein 1
• Protein Family: Juxtaposed with another zinc finger protein

NCBI Description

This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized [provided by RefSeq, Jul 2008]