Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGAXSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ITGAX Polyclonal Antibody | anti-ITGAX antibody

ITGAX Antibody - N-terminal region

Gene Names
Itgax; Cr4; N418; Cd11c; AI449405
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ITGAX; Polyclonal Antibody; ITGAX Antibody - N-terminal region; anti-ITGAX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THFHMDGAEFGHSVLQYDSSWVVVGAPKEIKATNQIGGLYKCGYHTGNCE
Sequence Length
1169
Applicable Applications for anti-ITGAX antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ITGAX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGAXSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGAXSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ITGAX antibody
Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis (By similarity).
Product Categories/Family for anti-ITGAX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128 kDa
NCBI Official Full Name
integrin alpha-X isoform 1
NCBI Official Synonym Full Names
integrin alpha X
NCBI Official Symbol
Itgax
NCBI Official Synonym Symbols
Cr4; N418; Cd11c; AI449405
NCBI Protein Information
integrin alpha-X
UniProt Protein Name
Integrin alpha-X
Protein Family
UniProt Gene Name
Itgax
UniProt Entry Name
ITAX_MOUSE

Uniprot Description

ITGAX: Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis. Belongs to the integrin alpha chain family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis

Cellular Component: cell surface; membrane; integral to membrane; integrin complex; external side of plasma membrane

Molecular Function: metal ion binding

Biological Process: integrin-mediated signaling pathway; heterotypic cell-cell adhesion; activated T cell proliferation; cell adhesion; defense response to virus

Research Articles on ITGAX

Similar Products

Product Notes

The ITGAX itgax (Catalog #AAA3224242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGAX Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ITGAX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGAX itgax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THFHMDGAEF GHSVLQYDSS WVVVGAPKEI KATNQIGGLY KCGYHTGNCE. It is sometimes possible for the material contained within the vial of "ITGAX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.