Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGAVSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ITGAV Polyclonal Antibody | anti-ITGAV antibody

ITGAV Antibody - C-terminal region

Gene Names
ITGAV; CD51; MSK8; VNRA; VTNR
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ITGAV; Polyclonal Antibody; ITGAV Antibody - C-terminal region; anti-ITGAV antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSE
Sequence Length
1048
Applicable Applications for anti-ITGAV antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ITGAV
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGAVSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGAVSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ITGAV antibody
The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
Product Categories/Family for anti-ITGAV antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115 kDa
NCBI Official Full Name
integrin alpha-V isoform 2
NCBI Official Synonym Full Names
integrin subunit alpha V
NCBI Official Symbol
ITGAV
NCBI Official Synonym Symbols
CD51; MSK8; VNRA; VTNR
NCBI Protein Information
integrin alpha-V
UniProt Protein Name
Integrin alpha-V
Protein Family
UniProt Gene Name
ITGAV
UniProt Synonym Gene Names
MSK8; VNRA
UniProt Entry Name
ITAV_HUMAN

NCBI Description

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

Uniprot Description

ITGAV: The alpha-V integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Belongs to the integrin alpha chain family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q31-q32

Cellular Component: filopodium membrane; focal adhesion; cell surface; membrane; integral to plasma membrane; microvillus membrane; plasma membrane; phagocytic vesicle; integrin complex; external side of plasma membrane

Molecular Function: voltage-gated calcium channel activity; viral receptor activity; protein binding; opsonin binding; insulin-like growth factor I binding; protein kinase C binding; protease binding; extracellular matrix binding; transforming growth factor beta binding; metal ion binding; fibronectin binding

Biological Process: negative regulation of lipid transport; axon guidance; entry of virus into host cell; extracellular matrix organization and biogenesis; positive regulation of cell adhesion; cell-matrix adhesion; negative chemotaxis; entry of symbiont into host cell by promotion of host phagocytosis; regulation of phagocytosis; antigen processing and presentation of peptide antigen via MHC class I; positive regulation of cell proliferation; antigen processing and presentation of exogenous peptide antigen via MHC class I; angiogenesis; cell adhesion; cell growth; integrin-mediated signaling pathway; cell migration; negative regulation of lipoprotein metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; cell-substrate adhesion; heterotypic cell-cell adhesion; negative regulation of low-density lipoprotein receptor biosynthetic process; positive regulation of osteoblast proliferation; vascular endothelial growth factor receptor signaling pathway; blood coagulation; leukocyte migration; apoptotic cell clearance; positive regulation of cell migration

Research Articles on ITGAV

Similar Products

Product Notes

The ITGAV itgav (Catalog #AAA3221724) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGAV Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGAV can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGAV itgav for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILAVLAGLLL LAVLVFVMYR MGFFKRVRPP QEEQEREQLQ PHENGEGNSE. It is sometimes possible for the material contained within the vial of "ITGAV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.