Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGALSample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ITGAL Polyclonal Antibody | anti-ITGAL antibody

ITGAL Antibody-C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGAL; Polyclonal Antibody; ITGAL Antibody-C-terminal region; integrin alpha-L; SHARPIN; env; UBC; F11R; RANBP9; ICAM5; PTPRC; ICAM1; ICAM3; ESM1; CD82; ITGB2; CD11A; LFA-1; LFA1A; anti-ITGAL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD
Applicable Applications for anti-ITGAL antibody
Western Blot (WB)
Protein Size
1223 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ITGAL
Predicted Homology Based on Immunogen Sequence
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGALSample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGALSample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ITGAL antibody
Description of Target: ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
134kDa
UniProt Protein Name
Integrin alpha-L
Protein Family
UniProt Gene Name
ITGAL
UniProt Synonym Gene Names
CD11A; LFA-1A
UniProt Entry Name
ITAL_HUMAN

Uniprot Description

ITGAL: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Belongs to the integrin alpha chain family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion; Cell surface

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cell surface; membrane; plasma membrane; immunological synapse; intercellular junction; integrin complex; external side of plasma membrane

Molecular Function: protein binding; protein heterodimerization activity; metal ion binding; protein complex binding; ICAM-3 receptor activity; cell adhesion molecule binding

Biological Process: integrin-mediated signaling pathway; extracellular matrix organization and biogenesis; regulation of immune response; cell-matrix adhesion; activated T cell proliferation; positive regulation of calcium-mediated signaling; signal transduction; receptor clustering; heterophilic cell adhesion; leukocyte adhesion; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; positive regulation of T cell proliferation; inflammatory response; blood coagulation; cell adhesion; cell motility; leukocyte migration

Similar Products

Product Notes

The ITGAL itgal (Catalog #AAA3249647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGAL Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGAL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGAL itgal for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LKEKMEAGRG VPNGIPAEDS EQLASGQEAG DPGCLKPLHE KDSESGGGKD. It is sometimes possible for the material contained within the vial of "ITGAL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.