Western Blot (WB)
(Western blot-ITFG1 Polyclonal Antibody)
Rabbit ITFG1 Polyclonal Antibody | anti-ITFG1 antibody
ITFG1 Polyclonal Antibody
Gene Names
ITFG1; TIP; CDA08; LNKN-1; 2310047C21Rik
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ITFG1; Polyclonal Antibody; ITFG1 Polyclonal Antibody; 2310047C21Rik; CDA08; LNKN-1; TIP; T-cell immunomodulatory protein; anti-ITFG1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.37 mg/ml (varies by lot)
Sequence Length
612
Applicable Applications for anti-ITFG1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 313-612 of human ITFG1 (NP_110417.2).
Immunogen Sequence
LWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM
Positive Samples
LO2, A-431, Mouse Heart, Mouse Pancreas, Mouse Testis,
Cellular Location
Membrane, Secreted, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-ITFG1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-ITFG1 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 68kDa
Observed: 80kDa
Observed: 80kDa
NCBI Official Full Name
T-cell immunomodulatory protein
NCBI Official Synonym Full Names
integrin alpha FG-GAP repeat containing 1
NCBI Official Symbol
ITFG1
NCBI Official Synonym Symbols
TIP; CDA08; LNKN-1; 2310047C21Rik
NCBI Protein Information
T-cell immunomodulatory protein
UniProt Protein Name
T-cell immunomodulatory protein
Protein Family
UniProt Gene Name
ITFG1
UniProt Synonym Gene Names
TIP; Protein TIP
UniProt Entry Name
TIP_HUMAN
Uniprot Description
ITFG1: Modulator of T-cell function. Has a protective effect in graft versus host disease model. Belongs to the TIP family.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 16q12.1
Cellular Component: integral to membrane
Research Articles on ITFG1
Similar Products
Product Notes
The ITFG1 itfg1 (Catalog #AAA9140599) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITFG1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITFG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ITFG1 itfg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITFG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
