Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IST1Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/mlIST1 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit IST1 Polyclonal Antibody | anti-IST1 antibody

IST1 Antibody - C-terminal region

Gene Names
IST1; OLC1; CHMP8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IST1; Polyclonal Antibody; IST1 Antibody - C-terminal region; anti-IST1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP
Sequence Length
335
Applicable Applications for anti-IST1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IST1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IST1Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/mlIST1 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (Host: RabbitTarget Name: IST1Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/mlIST1 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-IST1 antibody
This is a rabbit polyclonal antibody against IST1. It was validated on Western Blot

Target Description: IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvment in the MVB pathway is not established. IST1 is involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells.
Product Categories/Family for anti-IST1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
IST1 homolog isoform b
NCBI Official Synonym Full Names
IST1 factor associated with ESCRT-III
NCBI Official Symbol
IST1
NCBI Official Synonym Symbols
OLC1; CHMP8
NCBI Protein Information
IST1 homolog
UniProt Protein Name
IST1 homolog
Protein Family
UniProt Gene Name
IST1
UniProt Synonym Gene Names
KIAA0174; hIST1
UniProt Entry Name
IST1_HUMAN

NCBI Description

This gene encodes a protein with MIT-interacting motifs that interacts with components of endosomal sorting complexes required for transport (ESCRT). ESCRT functions in vesicle budding, such as that which occurs during membrane abscission in cytokinesis. There is a pseudogene for this gene on chromosome 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

IST1: Proposed to be involved in specific functions of the ESCRT machinery. Is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvement in the MVB pathway is not established. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. Belongs to the IST1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Cell cycle regulation

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: centrosome; cytoplasmic membrane-bound vesicle; ER-Golgi intermediate compartment; midbody; cytosol

Molecular Function: protein domain specific binding; protein binding; protein complex binding

Biological Process: release of virus from host; protein localization; establishment of protein localization; cell division; positive regulation of proteolysis; abscission; cytokinesis; viral capsid re-envelopment; positive regulation of collateral sprouting

Research Articles on IST1

Similar Products

Product Notes

The IST1 ist1 (Catalog #AAA3217552) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IST1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IST1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IST1 ist1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDLIDVGFTD DVKKGGPGRG GSGGFTAPVG GPDGTVPMPM PMPMPSANTP. It is sometimes possible for the material contained within the vial of "IST1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.