Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IRAK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit IRAK3 Polyclonal Antibody | anti-IRAK3 antibody

IRAK3 antibody - C-terminal region

Gene Names
IRAK3; ASRT5; IRAKM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IRAK3; Polyclonal Antibody; IRAK3 antibody - C-terminal region; anti-IRAK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
Sequence Length
596
Applicable Applications for anti-IRAK3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IRAK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IRAK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-IRAK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-IRAK3 antibody
This is a rabbit polyclonal antibody against IRAK3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
interleukin-1 receptor-associated kinase 3 isoform a
NCBI Official Synonym Full Names
interleukin 1 receptor associated kinase 3
NCBI Official Symbol
IRAK3
NCBI Official Synonym Symbols
ASRT5; IRAKM
NCBI Protein Information
interleukin-1 receptor-associated kinase 3
UniProt Protein Name
Interleukin-1 receptor-associated kinase 3
UniProt Gene Name
IRAK3
UniProt Synonym Gene Names
IRAK-3; IRAK-M
UniProt Entry Name
IRAK3_HUMAN

NCBI Description

This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophages and functions as a negative regulator of Toll-like receptor signaling. Mutations in this gene are associated with a susceptibility to asthma. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

IRAK3: a TKL kinase of the IRAK family. The interleukin-1 receptor-associated kinases are important mediators in the signal transduction of Toll-like receptor and IL1R family members, collectively referred to as TIRs.

Protein type: Protein kinase, TKL; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; TKL group; IRAK family

Chromosomal Location of Human Ortholog: 12q14.3

Cellular Component: interleukin-1 receptor complex; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein homodimerization activity; protein heterodimerization activity; magnesium ion binding; ATP binding

Biological Process: negative regulation of MAP kinase activity; regulation of protein complex disassembly; negative regulation of interleukin-12 production; cytokine and chemokine mediated signaling pathway; response to virus; protein amino acid autophosphorylation; response to lipopolysaccharide; negative regulation of tumor necrosis factor production; protein amino acid phosphorylation; activation of NF-kappaB transcription factor; MyD88-dependent toll-like receptor signaling pathway; response to exogenous dsRNA; negative regulation of innate immune response; inhibition of NF-kappaB transcription factor; response to peptidoglycan; toll-like receptor signaling pathway; negative regulation of interleukin-6 production; negative regulation of toll-like receptor signaling pathway; negative regulation of cytokine and chemokine mediated signaling pathway; negative regulation of protein catabolic process; negative regulation of protein complex disassembly

Disease: Asthma-related Traits, Susceptibility To, 5

Research Articles on IRAK3

Similar Products

Product Notes

The IRAK3 irak3 (Catalog #AAA3205428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IRAK3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IRAK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IRAK3 irak3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NTLESTQASL YFAEDPPTSL KSFRCPSPLF LENVPSIPVE DDESQNNNLL. It is sometimes possible for the material contained within the vial of "IRAK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.