Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-IQSEC1 Polyclonal Antibody)

Rabbit anti-Mouse, Rat IQSEC1 Polyclonal Antibody | anti-IQSEC1 antibody

IQSEC1 Polyclonal Antibody

Gene Names
IQSEC1; BRAG2; GEP100; ARFGEP100; ARF-GEP100
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IQSEC1; Polyclonal Antibody; IQSEC1 Polyclonal Antibody; ARF-GEP100; ARFGEP100; BRAG2; GEP100; IQ motif and Sec7 domain 1; anti-IQSEC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.41 mg/ml (varies by lot)
Sequence Length
963
Applicable Applications for anti-IQSEC1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:1000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 180-380 of human IQSEC1 (NP_055684.3).
Immunogen Sequence
SFEGPEKVHSSYFEGKQVSVTNDGSQLGALVSPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTEPQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCRSTPSLERQEQRLRVEHLPLL
Positive Samples
Mouse Brain, Rat Brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-IQSEC1 Polyclonal Antibody)

Western Blot (WB) (Western blot-IQSEC1 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 108kDa
Observed: 108kDa
NCBI Official Full Name
IQ motif and SEC7 domain-containing protein 1 isoform b
NCBI Official Synonym Full Names
IQ motif and Sec7 domain 1
NCBI Official Symbol
IQSEC1
NCBI Official Synonym Symbols
BRAG2; GEP100; ARFGEP100; ARF-GEP100
NCBI Protein Information
IQ motif and SEC7 domain-containing protein 1
UniProt Protein Name
IQ motif and SEC7 domain-containing protein 1
UniProt Gene Name
IQSEC1
UniProt Synonym Gene Names
ARFGEP100; BRAG2; KIAA0763
UniProt Entry Name
IQEC1_HUMAN

Uniprot Description

IQSEC1: In addition to accelerate GTP gamma S binding by ARFs of all three classes, it appears to function preferentially as a guanine nucleotide exchange protein for ARF6, mediating internalisation of beta-1 integrin. Belongs to the BRAG family. Interacts with ARF6. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; GAPs; GAPs, ARF

Chromosomal Location of Human Ortholog: 3p25.2

Cellular Component: membrane; trans-Golgi network; nucleus

Molecular Function: ARF guanyl-nucleotide exchange factor activity

Biological Process: vesicle-mediated transport; regulation of ARF protein signal transduction; actin cytoskeleton organization and biogenesis; positive regulation of GTPase activity

Research Articles on IQSEC1

Similar Products

Product Notes

The IQSEC1 iqsec1 (Catalog #AAA9140978) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IQSEC1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IQSEC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:1000. Researchers should empirically determine the suitability of the IQSEC1 iqsec1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IQSEC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.