Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IPO5Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human IPO5 Polyclonal Antibody | anti-IPO5 antibody

IPO5 Antibody - N-terminal region

Gene Names
IPO5; IMB3; Pse1; imp5; KPNB3; RANBP5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IPO5; Polyclonal Antibody; IPO5 Antibody - N-terminal region; anti-IPO5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQM
Sequence Length
1097
Applicable Applications for anti-IPO5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human IPO5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IPO5Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IPO5Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IPO5 antibody
This is a rabbit polyclonal antibody against IPO5. It was validated on Western Blot

Target Description: Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.
Product Categories/Family for anti-IPO5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
Importin-5
NCBI Official Synonym Full Names
importin 5
NCBI Official Symbol
IPO5
NCBI Official Synonym Symbols
IMB3; Pse1; imp5; KPNB3; RANBP5
NCBI Protein Information
importin-5
UniProt Protein Name
Importin-5
Protein Family
UniProt Gene Name
IPO5
UniProt Synonym Gene Names
KPNB3; RANBP5; Imp5; RanBP5
UniProt Entry Name
IPO5_HUMAN

NCBI Description

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. [provided by RefSeq, Jul 2008]

Uniprot Description

KPNB3: Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Belongs to the importin beta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Karyopherin; Nucleolus; Nuclear import

Chromosomal Location of Human Ortholog: 13q32.2

Cellular Component: nucleoplasm; Golgi apparatus; nuclear membrane; intracellular membrane-bound organelle; membrane; cytoplasm; nucleolus; nuclear pore; nucleus

Molecular Function: protein binding; Ran GTPase binding; protein transporter activity; GTPase inhibitor activity

Biological Process: ribosomal protein import into nucleus; positive regulation of protein import into nucleus; viral reproduction; negative regulation of catalytic activity; NLS-bearing substrate import into nucleus

Research Articles on IPO5

Similar Products

Product Notes

The IPO5 ipo5 (Catalog #AAA3219895) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IPO5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IPO5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IPO5 ipo5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDEDWANADE LEDDDFDSNA VAGESALDRM ACGLGGKLVL PMIKEHIMQM. It is sometimes possible for the material contained within the vial of "IPO5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.