Western Blot (WB)
(WB Suggested Anti-INPP5K AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Rabbit INPP5K Polyclonal Antibody | anti-INPP5K antibody
INPP5K antibody - C-terminal region
Gene Names
INPP5K; PPS; SKIP; MDCCAID
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
INPP5K; Polyclonal Antibody; INPP5K antibody - C-terminal region; anti-INPP5K antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF
Sequence Length
448
Applicable Applications for anti-INPP5K antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%; Yeast: 83%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human INPP5K
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-INPP5K AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-INPP5K AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-INPP5K antibody
This is a rabbit polyclonal antibody against INPP5K. It was validated on Western Blot
Target Description: This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified.
Target Description: This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-INPP5K antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
inositol polyphosphate 5-phosphatase K isoform 1
NCBI Official Synonym Full Names
inositol polyphosphate-5-phosphatase K
NCBI Official Symbol
INPP5K
NCBI Official Synonym Symbols
PPS; SKIP; MDCCAID
NCBI Protein Information
inositol polyphosphate 5-phosphatase K
UniProt Protein Name
Inositol polyphosphate 5-phosphatase K
Protein Family
UniProt Gene Name
INPP5K
UniProt Synonym Gene Names
PPS; SKIP
UniProt Entry Name
INP5K_HUMAN
NCBI Description
This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008]
Research Articles on INPP5K
Similar Products
Product Notes
The INPP5K inpp5k (Catalog #AAA3215103) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INPP5K antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's INPP5K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the INPP5K inpp5k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPTYKFDRNS NDYDTSEKKR KPAWTDRILW RLKRQPCAGP DTPIPPASHF. It is sometimes possible for the material contained within the vial of "INPP5K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
