Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of SH-SY5Y cells, using INPP5E antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

Rabbit INPP5E Polyclonal Antibody | anti-INPP5E antibody

INPP5E Rabbit pAb

Gene Names
INPP5E; CPD4; CORS1; JBTS1; MORMS; PPI5PIV
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
INPP5E; Polyclonal Antibody; INPP5E Rabbit pAb; CORS1; CPD4; JBTS1; MORMS; PPI5PIV; pharbin; anti-INPP5E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQ
Applicable Applications for anti-INPP5E antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 510-630 of human INPP5E (NP_063945.2).
Positive Samples
SH-SY5Y
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of SH-SY5Y cells, using INPP5E antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

Western Blot (WB) (Western blot analysis of extracts of SH-SY5Y cells, using INPP5E antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of C6 cells using INPP5E antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of C6 cells using INPP5E antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of L929 cells using INPP5E antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of L929 cells using INPP5E antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-INPP5E antibody
Background: The protein encoded by this gene is an inositol 1, 4, 5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1, 4, 5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. Studies of the mouse counterpart suggest that this protein may hydrolyze phosphatidylinositol 3, 4, 5-trisphosphate and phosphatidylinositol 3, 5-bisphosphate on the cytoplasmic Golgi membrane and thereby regulate Golgi-vesicular trafficking. Mutations in this gene cause Joubert syndrome; a clinically and genetically heterogenous group of disorders characterized by midbrain-hindbrain malformation and various associated ciliopathies that include retinal dystrophy, nephronophthisis, liver fibrosis and polydactyly. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,145 Da
NCBI Official Full Name
Homo sapiens inositol polyphosphate-5-phosphatase, 72 kDa (INPP5E), nuclear gene encoding mitochondrial protein, mRNA
NCBI Official Synonym Full Names
inositol polyphosphate-5-phosphatase, 72 kDa
NCBI Official Symbol
INPP5E
NCBI Official Synonym Symbols
CPD4; CORS1; JBTS1; MORMS; PPI5PIV
NCBI Protein Information
72 kDa inositol polyphosphate 5-phosphatase; phosphatidylinositol 4,5-bisphosphate 5-phosphatase; phosphatidylinositol-4,5-bisphosphate 5-phosphatase; phosphatidylinositol (4,5) bisphosphate 5-phosphatase; phosphatidylinositol polyphosphate 5-phosphatase
UniProt Protein Name
72 kDa inositol polyphosphate 5-phosphatase
UniProt Gene Name
INPP5E
UniProt Entry Name
INP5E_HUMAN

Uniprot Description

INPP5E: Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns-P2. Specific for lipid substrates, inactive towards water soluble inositol phosphates. Defects in INPP5E are the cause of Joubert syndrome type 1 (JBTS1). A disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy and renal disease. Defects in INPP5E are the cause of mental retardation- truncal obesity-retinal dystrophy-micropenis (MORMS). An autosomal recessive disorder characterized by moderate mental retardation, truncal obesity, congenital non-progressive retinal dystrophy, and micropenis in males. The phenotype is similar to Bardet-Biedl syndrome and Cohen syndrome Distinguishing features are the age of onset, the non-progressive nature of the visual impairment, lack of dysmorphic facies, skin or gingival infection, microcephaly, mottled retina, polydactyly, and testicular anomalies. Belongs to the inositol 1,4,5-trisphosphate 5- phosphatase type IV family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphatase (non-protein); Carbohydrate Metabolism - inositol phosphate; EC 3.1.3.36

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: ruffle; cytoskeleton; plasma membrane; axoneme; cytosol

Molecular Function: phosphoinositide 5-phosphatase activity; inositol-polyphosphate 5-phosphatase activity

Biological Process: phospholipid metabolic process; organelle organization and biogenesis; inositol phosphate dephosphorylation; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation

Disease: Mental Retardation, Truncal Obesity, Retinal Dystrophy, And Micropenis Syndrome; Joubert Syndrome 1

Similar Products

Product Notes

The INPP5E inpp5e (Catalog #AAA9142977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INPP5E Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's INPP5E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the INPP5E inpp5e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LIREMRKGSI FKGFQEPDIH FLPSYKFDIG KDTYDSTSKQ RTPSYTDRVL YRSRHKGDIC PVSYSSCPGI KTSDHRPVYG LFRVKVRPGR DNIPLAAGKF DRELYLLGIK RRISKEIQRQ Q. It is sometimes possible for the material contained within the vial of "INPP5E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.