Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: INHBCAntibody Dilution: 1.0ug/mlSample Type: OVCAR-3 cell lysateINHBC is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit anti-Horse, Human INHBC Polyclonal Antibody | anti-INHBC antibody

INHBC antibody - N-terminal region

Gene Names
INHBC; IHBC
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
INHBC; Polyclonal Antibody; INHBC antibody - N-terminal region; anti-INHBC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN
Sequence Length
352
Applicable Applications for anti-INHBC antibody
Western Blot (WB)
Homology
Horse: 77%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: INHBCAntibody Dilution: 1.0ug/mlSample Type: OVCAR-3 cell lysateINHBC is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (Host: RabbitTarget Name: INHBCAntibody Dilution: 1.0ug/mlSample Type: OVCAR-3 cell lysateINHBC is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-INHBC antibody
This is a rabbit polyclonal antibody against INHBC. It was validated on Western Blot

Target Description: This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types.
Product Categories/Family for anti-INHBC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
inhibin beta C chain preproprotein
NCBI Official Synonym Full Names
inhibin subunit beta C
NCBI Official Symbol
INHBC
NCBI Official Synonym Symbols
IHBC
NCBI Protein Information
inhibin beta C chain
UniProt Protein Name
Inhibin beta C chain
Protein Family
UniProt Gene Name
INHBC
UniProt Entry Name
INHBC_HUMAN

NCBI Description

This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric complex may function in the inhibition of activin A signaling. Transgenic mice overexpressing this gene exhibit defects in testis, liver and prostate. [provided by RefSeq, Aug 2016]

Uniprot Description

INHBC: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; hormone activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; regulation of MAPKKK cascade; cell development; growth

Research Articles on INHBC

Similar Products

Product Notes

The INHBC inhbc (Catalog #AAA3216610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INHBC antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's INHBC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the INHBC inhbc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QECEIISFAE TGLSTINQTR LDFHFSSDRT AGDREVQQAS LMFFVQLPSN. It is sometimes possible for the material contained within the vial of "INHBC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.