Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (INADL antibody (MBS5300606) used at 1 ug/ml to detect target protein.)

Rabbit INADL Polyclonal Antibody | anti-INADL antibody

INADL antibody

Gene Names
INADL; Cipp; PATJ; hINADL; InaD-like
Applications
Western Blot
Purity
Affinity purified
Synonyms
INADL; Polyclonal Antibody; INADL antibody; Polyclonal INADL; Anti-INADL; Cipp; PATJ; Inad-Like; FLJ26982; anti-INADL antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INADL antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1801
Applicable Applications for anti-INADL antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
INADL is a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.
Cross-Reactivity
Human
Immunogen
INADL antibody was raised using a synthetic peptide corresponding to a region with amino acids EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(INADL antibody (MBS5300606) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (INADL antibody (MBS5300606) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-INADL antibody
Rabbit polyclonal INADL antibody
Product Categories/Family for anti-INADL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
196 kDa (MW of target protein)
NCBI Official Full Name
inaD-like protein
NCBI Official Synonym Full Names
InaD-like (Drosophila)
NCBI Official Symbol
INADL
NCBI Official Synonym Symbols
Cipp; PATJ; hINADL; InaD-like
NCBI Protein Information
inaD-like protein
UniProt Protein Name
InaD-like protein
UniProt Gene Name
INADL
UniProt Synonym Gene Names
PATJ; Inadl protein; hINADL
UniProt Entry Name
INADL_HUMAN

NCBI Description

This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. [provided by RefSeq, Jul 2008]

Uniprot Description

INADL: Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: tight junction; protein complex; perinuclear region of cytoplasm; apical plasma membrane; plasma membrane

Molecular Function: protein binding

Biological Process: intercellular junction assembly and maintenance

Research Articles on INADL

Similar Products

Product Notes

The INADL inadl (Catalog #AAA5300606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's INADL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the INADL inadl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "INADL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.