Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using IMPDH1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit IMPDH1 Polyclonal Antibody | anti-IMPDH1 antibody

IMPDH1 Rabbit pAb

Gene Names
IMPDH1; IMPD; RP10; IMPD1; LCA11; IMPDH-I; sWSS2608
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
IMPDH1; Polyclonal Antibody; IMPDH1 Rabbit pAb; IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608; anti-IMPDH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Applicable Applications for anti-IMPDH1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 434-563 of human IMPDH1 (NP_899066.1).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
BT-474, HT-29, Mouse pancreas
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using IMPDH1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using IMPDH1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-IMPDH1 antibody
Background: The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,898 Da
NCBI Official Full Name
inosine-5'-monophosphate dehydrogenase 1 isoform a
NCBI Official Synonym Full Names
IMP (inosine 5'-monophosphate) dehydrogenase 1
NCBI Official Symbol
IMPDH1
NCBI Official Synonym Symbols
IMPD; RP10; IMPD1; LCA11; IMPDH-I; sWSS2608
NCBI Protein Information
inosine-5'-monophosphate dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1; IMPD 1; IMPDH 1
UniProt Protein Name
Inosine-5'-monophosphate dehydrogenase 1
UniProt Gene Name
IMPDH1
UniProt Entry Name
IMDH1_HUMAN

NCBI Description

The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

Uniprot Description

IMPDH1: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors. Defects in IMPDH1 are the cause of retinitis pigmentosa type 10 (RP10). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP10 inheritance is autosomal dominant. Defects in IMPDH1 are the cause of Leber congenital amaurosis type 11 (LCA11). LCA11 is a severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus. Belongs to the IMPDH/GMPR family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; EC 1.1.1.205; Nucleotide Metabolism - purine; Oxidoreductase

Chromosomal Location of Human Ortholog: 7q31.3-q32

Cellular Component: nucleoplasm; cytoplasm; cell junction; nucleus; cytosol

Molecular Function: DNA binding; nucleic acid binding; RNA binding; metal ion binding; nucleotide binding; IMP dehydrogenase activity

Biological Process: lymphocyte proliferation; purine ribonucleoside monophosphate biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; GMP biosynthetic process; purine base metabolic process

Disease: Leber Congenital Amaurosis 11; Retinitis Pigmentosa 10

Research Articles on IMPDH1

Similar Products

Product Notes

The IMPDH1 impdh1 (Catalog #AAA9142511) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IMPDH1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IMPDH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the IMPDH1 impdh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMGSLLAATT EAPGEYFFSD GVRLKKYRGM GSLDAMEKSS SSQKRYFSEG DKVKIAQGVS GSIQDKGSIQ KFVPYLIAGI QHGCQDIGAR SLSVLRSMMY SGELKFEKRT MSAQIEGGVH GLHSYEKRLY. It is sometimes possible for the material contained within the vial of "IMPDH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.