Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IMPAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Rabbit IMPAD1 Polyclonal Antibody | anti-IMPAD1 antibody

IMPAD1 antibody - middle region

Gene Names
IMPAD1; GPAPP; IMP 3; IMP-3; IMPA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IMPAD1; Polyclonal Antibody; IMPAD1 antibody - middle region; anti-IMPAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII
Sequence Length
359
Applicable Applications for anti-IMPAD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IMPAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IMPAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-IMPAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Related Product Information for anti-IMPAD1 antibody
This is a rabbit polyclonal antibody against IMPAD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-IMPAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
inositol monophosphatase 3
NCBI Official Synonym Full Names
inositol monophosphatase domain containing 1
NCBI Official Symbol
IMPAD1
NCBI Official Synonym Symbols
GPAPP; IMP 3; IMP-3; IMPA3
NCBI Protein Information
inositol monophosphatase 3
UniProt Protein Name
Inositol monophosphatase 3
Protein Family
UniProt Gene Name
IMPAD1
UniProt Synonym Gene Names
IMPA3; IMP 3; IMPase 3; Golgi-resident PAP phosphatase; gPAPP
UniProt Entry Name
IMPA3_HUMAN

NCBI Description

This gene encodes a member of the inositol monophosphatase family. The encoded protein is localized to the Golgi apparatus and catalyzes the hydrolysis of phosphoadenosine phosphate (PAP) to adenosine monophosphate (AMP). Mutations in this gene are a cause of GRAPP type chondrodysplasia with joint dislocations, and a pseudogene of this gene is located on the long arm of chromosome 1. [provided by RefSeq, Dec 2011]

Uniprot Description

IMPAD1: May play a role in the formation of skeletal elements derived through endochondral ossification, possibly by clearing adenosine 3',5'-bisphosphate produced by Golgi sulfotransferases during glycosaminoglycan sulfation. Defects in IMPAD1 are the cause of chondrodysplasia with joint dislocations GPAPP type (CDP-GPAPP). A condition consisting of congenital joint dislocations, chondrodysplasia with short stature, micrognathia and cleft palate, and a distinctive face. Belongs to the inositol monophosphatase family.

Protein type: Membrane protein, integral; EC 3.1.3.25; Phosphatase (non-protein); EC 3.1.3.7

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: Golgi apparatus; membrane; integral to membrane

Molecular Function: 3'-nucleotidase activity; metal ion binding; inositol-1(or 4)-monophosphatase activity; 3'(2'),5'-bisphosphate nucleotidase activity

Biological Process: chondroitin sulfate metabolic process; dephosphorylation; phosphoinositide phosphorylation; inositol biosynthetic process; embryonic digit morphogenesis; chondrocyte development; endochondral ossification; post-embryonic development

Disease: Chondrodysplasia With Joint Dislocations, Gpapp Type

Research Articles on IMPAD1

Similar Products

Product Notes

The IMPAD1 impad1 (Catalog #AAA3208523) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IMPAD1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IMPAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IMPAD1 impad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAWAMVDGGS NVKARSSYNE KTPRIVVSRS HSGMVKQVAL QTFGNQTTII. It is sometimes possible for the material contained within the vial of "IMPAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.