Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IMP4 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellIMP4 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit IMP4 Polyclonal Antibody | anti-IMP4 antibody

IMP4 antibody - C-terminal region

Gene Names
IMP4; BXDC4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IMP4; Polyclonal Antibody; IMP4 antibody - C-terminal region; anti-IMP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSTE
Sequence Length
291
Applicable Applications for anti-IMP4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IMP4 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellIMP4 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-IMP4 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellIMP4 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-IMP4 antibody
This is a rabbit polyclonal antibody against IMP4. It was validated on Western Blot

Target Description: IMP4 forms a ternary complex with IMP3 and MPP10 that interacts with U3 small nucleolar RNA (snoRNA), which is required for the early cleavage steps in pre-rRNA processing.
Product Categories/Family for anti-IMP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
U3 small nucleolar ribonucleoprotein protein IMP4 isoform a
NCBI Official Synonym Full Names
IMP U3 small nucleolar ribonucleoprotein 4
NCBI Official Symbol
IMP4
NCBI Official Synonym Symbols
BXDC4
NCBI Protein Information
U3 small nucleolar ribonucleoprotein protein IMP4
UniProt Protein Name
U3 small nucleolar ribonucleoprotein protein IMP4
UniProt Gene Name
IMP4
UniProt Synonym Gene Names
BXDC4; U3 snoRNP protein IMP4
UniProt Entry Name
IMP4_HUMAN

NCBI Description

The protein encoded by this gene, along with IMP3 and MPP10, is part of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. This complex is necessary for the early cleavage steps of pre-18S ribosomal RNA processing. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Similar Products

Product Notes

The IMP4 imp4 (Catalog #AAA3216679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IMP4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IMP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IMP4 imp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VELTEVGPRF ELKLYMIRLG TLEQEATADV EWRWHPYTNT ARKRVFLSTE. It is sometimes possible for the material contained within the vial of "IMP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.