Western Blot (WB)
(Host: RabbitTarget Name: IMMTSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit IMMT Polyclonal Antibody | anti-IMMT antibody
IMMT Antibody - N-terminal region
Gene Names
IMMT; HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89; MICOS60
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
IMMT; Polyclonal Antibody; IMMT Antibody - N-terminal region; anti-IMMT antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIIS
Sequence Length
726
Applicable Applications for anti-IMMT antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 85%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human IMMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: IMMTSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: IMMTSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IMMT antibody
This is a rabbit polyclonal antibody against IMMT. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-IMMT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
MICOS complex subunit MIC60 isoform X3
NCBI Official Synonym Full Names
inner membrane mitochondrial protein
NCBI Official Symbol
IMMT
NCBI Official Synonym Symbols
HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89; MICOS60
NCBI Protein Information
MICOS complex subunit MIC60
UniProt Protein Name
MICOS complex subunit MIC60
UniProt Gene Name
IMMT
UniProt Synonym Gene Names
HMP; MIC60; MINOS2
UniProt Entry Name
MIC60_HUMAN
Uniprot Description
IMMT: 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Mitochondrial; Membrane protein, integral
Chromosomal Location of Human Ortholog: 2p11.2|2
Cellular Component: mitochondrion; membrane; mitochondrial inner membrane; integral to membrane
Molecular Function: protein binding
Biological Process: mitochondrial calcium ion homeostasis; response to cold
Research Articles on IMMT
Similar Products
Product Notes
The IMMT immt (Catalog #AAA3215344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IMMT Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IMMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IMMT immt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKSIQSGPLK ISSVSEVMKE SKQPASQLQK QKGDTPASAT APTEAAQIIS. It is sometimes possible for the material contained within the vial of "IMMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
