Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human esophagus using IL7R antibody at dilution of 1:100 (40x lens).)
Rabbit anti-Human IL7R Polyclonal Antibody | anti-IL7R antibody
IL7R Polyclonal Antibody
Gene Names
IL7R; ILRA; CD127; IL7RA; CDW127; IL-7R-alpha
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
IL7R; Polyclonal Antibody; IL7R Polyclonal Antibody; CD127; CDW127; IL-7R-alpha; IL7RA; ILRA; anti-IL7R antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD
Sequence Length
459
Applicable Applications for anti-IL7R antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human IL7R
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human esophagus using IL7R antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human esophagus using IL7R antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-IL7R antibody
The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.
Product Categories/Family for anti-IL7R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa/29kDa/34kDa/51kDa
NCBI Official Full Name
interleukin-7 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 7 receptor
NCBI Official Symbol
IL7R
NCBI Official Synonym Symbols
ILRA; CD127; IL7RA; CDW127; IL-7R-alpha
NCBI Protein Information
interleukin-7 receptor subunit alpha
UniProt Protein Name
Interleukin-7 receptor subunit alpha
Protein Family
UniProt Gene Name
IL7R
UniProt Synonym Gene Names
IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA
NCBI Description
The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found. [provided by RefSeq, Dec 2015]
Uniprot Description
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Research Articles on IL7R
Similar Products
Product Notes
The IL7R il7r (Catalog #AAA9133543) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL7R Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL7R can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the IL7R il7r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ESGYAQNGDL EDAELDDYSF SCYSQLEVNG SQHSLTCAFE DPDVNITNLE FEICGALVEV KCLNFRKLQE IYFIETKKFL LIGKSNICVK VGEKSLTCKK IDLTTIVKPE APFDLSVVYR EGANDFVVTF NTSHLQKKYV KVLMHDVAYR QEKDENKWTH VNLSSTKLTL LQRKLQPAAM YEIKVRSIPD HYFKGFWSEW SPSYYFRTPE INNSSGEMD. It is sometimes possible for the material contained within the vial of "IL7R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
