Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL33Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human IL33 Polyclonal Antibody | anti-IL33 antibody

IL33 Antibody - middle region

Gene Names
IL33; DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IL33; Polyclonal Antibody; IL33 Antibody - middle region; anti-IL33 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRAL
Sequence Length
270
Applicable Applications for anti-IL33 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IL33
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL33Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL33Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IL33 antibody
The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-IL33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
interleukin-33 isoform b
NCBI Official Synonym Full Names
interleukin 33
NCBI Official Symbol
IL33
NCBI Official Synonym Symbols
DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26
NCBI Protein Information
interleukin-33
UniProt Protein Name
Interleukin-33
Protein Family
UniProt Gene Name
IL33
UniProt Synonym Gene Names
C9orf26; IL1F11; NFHEV; IL-33; IL-1F11; NF-HEV
UniProt Entry Name
IL33_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

IL33: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Induces T-helper type 2-associated cytokines. Belongs to the IL-1 family. Highly divergent. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 9p24.1

Cellular Component: extracellular space; transport vesicle; chromosome; nucleus

Molecular Function: protein binding; cytokine activity

Biological Process: negative regulation of T-helper 1 type immune response; T-helper 2 type immune response; positive regulation of T-helper 2 type immune response; transcription, DNA-dependent; positive regulation of interleukin-6 production; positive regulation of immunoglobulin secretion; negative regulation of leukocyte migration; positive regulation of interleukin-4 production; negative regulation of immunoglobulin secretion; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of interferon-gamma production; positive regulation of transcription from RNA polymerase II promoter; positive regulation of interleukin-13 production; positive regulation of interleukin-5 production; positive regulation of inflammatory response; positive regulation of macrophage activation

Research Articles on IL33

Similar Products

Product Notes

The IL33 il33 (Catalog #AAA3224142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL33 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL33 il33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFRRETTKRP SLKTGRKHKR HLVLAACQQQ STVECFAFGI SGVQKYTRAL. It is sometimes possible for the material contained within the vial of "IL33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.