Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IL3 expression in transfected 293T cell line by IL3 polyclonal antibody. Lane 1: IL3 transfected lysate (17.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human IL3 Polyclonal Antibody | anti-IL3 antibody

IL3 (Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor, MGC79398, MGC79399) (FITC)

Gene Names
IL3; IL-3; MCGF; MULTI-CSF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL3; Polyclonal Antibody; IL3 (Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-stimulating Factor; P-cell-stimulating Factor; MGC79398; MGC79399) (FITC); anti-IL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-IL3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL3, aa1-152 (AAH69472.1).
Immunogen Sequence
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL3 expression in transfected 293T cell line by IL3 polyclonal antibody. Lane 1: IL3 transfected lysate (17.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL3 expression in transfected 293T cell line by IL3 polyclonal antibody. Lane 1: IL3 transfected lysate (17.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IL3 antibody
Interleukin-3 is a pleiotropic cytokine produced primarily by activated T cells. IL-13 is thought to function via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines. IL-3 has also been shown to affect the functional activity of a variety of other cell types including mast cells, eosinophils, megakaryocytes and basophils
Product Categories/Family for anti-IL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.1 kDa
NCBI Official Full Name
Interleukin 3,
NCBI Official Synonym Full Names
interleukin 3
NCBI Official Symbol
IL3
NCBI Official Synonym Symbols
IL-3; MCGF; MULTI-CSF
NCBI Protein Information
interleukin-3
UniProt Protein Name
Interleukin-3
Protein Family
UniProt Gene Name
IL3
UniProt Synonym Gene Names
IL-3; MCGF
UniProt Entry Name
IL3_HUMAN

NCBI Description

The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]

Uniprot Description

IL3: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Belongs to the IL-3 family.

Protein type: Cytokine; Oncoprotein; Apoptosis; Secreted; Secreted, signal peptide; Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-3 receptor binding; growth factor activity; cytokine activity

Biological Process: nervous system development; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of tyrosine phosphorylation of Stat5 protein; cell-cell signaling; embryonic hemopoiesis; cytokine and chemokine mediated signaling pathway; positive regulation of cell proliferation; immune response; positive regulation of myeloid leukocyte differentiation; positive regulation of DNA replication

Research Articles on IL3

Similar Products

Product Notes

The IL3 il3 (Catalog #AAA6382797) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL3 (Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor, MGC79398, MGC79399) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL3 il3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.