Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL18R1 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Rabbit anti-Human IL18R1 Polyclonal Antibody | anti-IL18R1 antibody

IL18R1 antibody - N-terminal region

Gene Names
IL18R1; CD218a; IL18RA; IL1RRP; CDw218a; IL-1Rrp
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL18R1; Polyclonal Antibody; IL18R1 antibody - N-terminal region; anti-IL18R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE
Sequence Length
541
Applicable Applications for anti-IL18R1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IL18R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL18R1 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-IL18R1 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)
Related Product Information for anti-IL18R1 antibody
This is a rabbit polyclonal antibody against IL18R1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to i
Product Categories/Family for anti-IL18R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
interleukin-18 receptor 1 isoform 1
NCBI Official Synonym Full Names
interleukin 18 receptor 1
NCBI Official Symbol
IL18R1
NCBI Official Synonym Symbols
CD218a; IL18RA; IL1RRP; CDw218a; IL-1Rrp
NCBI Protein Information
interleukin-18 receptor 1
UniProt Protein Name
Interleukin-18 receptor 1
Protein Family
UniProt Gene Name
IL18R1
UniProt Synonym Gene Names
IL1RRP; IL-18R-1; IL-18R1; IL-1Rrp; IL1R-rp
UniProt Entry Name
IL18R_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to induce the expression of this receptor in NK and T cells. This gene along with four other members of the interleukin 1 receptor family, including IL1R2, IL1R1, ILRL2 (IL-1Rrp2), and IL1RL1 (T1/ST2), form a gene cluster on chromosome 2q. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

IL18R1: Receptor for interleukin 18 (IL-18). Binding to the agonist leads to the activation of NF-kappa-B. Belongs to the interleukin-1 receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding; receptor activity; interleukin-1 receptor activity; interleukin-18 receptor activity

Biological Process: positive regulation of interferon-gamma production; T-helper 1 cell differentiation; natural killer cell activation; positive regulation of NF-kappaB import into nucleus; immune response; signal transduction

Research Articles on IL18R1

Similar Products

Product Notes

The IL18R1 il18r1 (Catalog #AAA3208186) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL18R1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL18R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL18R1 il18r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFYLKHCSCS LAHEIETTTK SWYKSSGSQE HVELNPRSSS RIALHDCVLE. It is sometimes possible for the material contained within the vial of "IL18R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.