Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of IL-18R Beta/IL-18RAP using anti-IL-18R Beta/IL-18RAP antibody (MBS1753733).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HL-60 whole cell lysatesLane 2: human A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-IL-18R Beta/IL-18RAP antigen affinity purified polyclonal antibody (Catalog # MBS1753733) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # MBS176460) with Tanon 5200 system. A specific band was detected for IL-18R Beta/IL-18RAP at approximately 72KD. The expected band size for IL-18R Beta/IL-18RAP is at 72KD. )

Rabbit anti-Human IL-18R Beta/IL-18RAP Polyclonal Antibody | anti-IL18RAP antibody

Anti-IL-18R Beta/IL-18RAP Antibody

Gene Names
IL18RAP; ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
IL-18R Beta/IL-18RAP; Polyclonal Antibody; Anti-IL-18R Beta/IL-18RAP Antibody; IL18RAP; IL1R7; Interleukin-18 receptor accessory protein; IL-18 receptor accessory protein; IL-18RAcP; Accessory protein-like; AcPL; CD218 antigen-like family member B; CDw218b; IL-1R accessory protein-like; IL-1RAcPL; Interleukin-1 receptor 7; IL-1R-7; IL-1R7; Interleukin-18 receptor accessory protein-like; Interleukin-18 receptor beta; IL-18R-beta; IL-18Rbeta; CD antigen CD218b; interleukin 18 receptor accessory protein; anti-IL18RAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for IL-18R Beta/IL-18RAP detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.005mg NaN3.
Applicable Applications for anti-IL18RAP antibody
Western Blot (WB)
Application Notes
WB: 0.25-0.5ug/ml|Human|
Immunogen
A synthetic peptide corresponding to a sequence of human IL-18R Beta/IL-18RAP (SIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALR).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of IL-18R Beta/IL-18RAP using anti-IL-18R Beta/IL-18RAP antibody (MBS1753733).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HL-60 whole cell lysatesLane 2: human A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-IL-18R Beta/IL-18RAP antigen affinity purified polyclonal antibody (Catalog # MBS1753733) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # MBS176460) with Tanon 5200 system. A specific band was detected for IL-18R Beta/IL-18RAP at approximately 72KD. The expected band size for IL-18R Beta/IL-18RAP is at 72KD. )

Western Blot (WB) (Figure 1. Western blot analysis of IL-18R Beta/IL-18RAP using anti-IL-18R Beta/IL-18RAP antibody (MBS1753733).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HL-60 whole cell lysatesLane 2: human A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-IL-18R Beta/IL-18RAP antigen affinity purified polyclonal antibody (Catalog # MBS1753733) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # MBS176460) with Tanon 5200 system. A specific band was detected for IL-18R Beta/IL-18RAP at approximately 72KD. The expected band size for IL-18R Beta/IL-18RAP is at 72KD. )
Related Product Information for anti-IL18RAP antibody
Interleukin 18 receptor accessory protein, also known as IL18RAP and CDw218b (cluster of differentiation w218b), is a human gene. The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
References
1. Born, T. L., Thomassen, E., Bird, T. A., Sims, J. E. Cloning of a novel receptor subunit, AcPL, required for interleukin-18 signaling. J. Biol. Chem. 273: 29445-29450, 1998.
2. Koskinen, L. L. E., Einarsdottir, E., Dukes, E., Heap, G. A. R., Dubois, P., Korponay-Szabo, I. R., Kaukinen, K., Kurppa, K., Ziberna, F., Vatta, S., Not, T., Ventura, A., and 9 others. Association study of the IL18RAP locus in three European populations with coeliac disease. Hum. Molec. Genet. 18: 1148-1155, 2009.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
599
NCBI Official Full Name
Interleukin-18 receptor accessory protein
NCBI Official Synonym Full Names
interleukin 18 receptor accessory protein
NCBI Official Symbol
IL18RAP
NCBI Official Synonym Symbols
ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
NCBI Protein Information
interleukin-18 receptor accessory protein; IL-18 receptor beta; interleukin-1 receptor 7; interleukin-18 receptor beta; IL-18 receptor accessory protein; cluster of differentiation w218b; CD218 antigen-like family member B
UniProt Protein Name
Interleukin-18 receptor accessory protein
UniProt Gene Name
IL18RAP
UniProt Synonym Gene Names
IL1R7; IL-18 receptor accessory protein; IL-18RAcP; AcPL; IL-1RAcPL; IL-1R-7; IL-1R7; IL-18R-beta; IL-18Rbeta
UniProt Entry Name
I18RA_HUMAN

NCBI Description

The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

Uniprot Description

IL18RAP: Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK. Belongs to the interleukin-1 receptor family.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to membrane

Molecular Function: receptor activity

Biological Process: cell surface receptor linked signal transduction; immune response; inflammatory response

Research Articles on IL18RAP

Similar Products

Product Notes

The IL18RAP il18rap (Catalog #AAA1753733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-IL-18R Beta/IL-18RAP Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL-18R Beta/IL-18RAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.25-0.5ug/ml|Human|. Researchers should empirically determine the suitability of the IL18RAP il18rap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL-18R Beta/IL-18RAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.