Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of IKK gamma using anti-IKK gamma antibody (MBS178627).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: rat cardiac muscle tissue lysates,lane 2: HEPG2 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IKK gamma antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IKK gamma at approximately 48KD. The expected band size for IKK gamma is at 48KD. )

Rabbit anti-Human, Rat IKK gamma Polyclonal Antibody | anti-IKBKG antibody

Anti-IKK gamma Antibody

Gene Names
IKBKG; IP; IP1; IP2; FIP3; IKKG; IPD2; NEMO; FIP-3; Fip3p; IMD33; AMCBX1; IKKAP1; ZC2HC9; IKK-gamma
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
IKK gamma; Polyclonal Antibody; Anti-IKK gamma Antibody; AMCBX1; FIP 3; FIP3; FIP-3; NEMO; I kappa B kinase gamma; I-kappa-B kinase subunit gamma; IkB kinase gamma subunit; IkB kinase subunit gamma; IkB kinase-associated protein 1; IKBKG; IKKAP 1; IKKAP1; IKKG; IKKgamma; IKK-gamma; Incontinentia pigmenti; IP2; IPD2; NF-kappa-B essential modifier; NF-kappa-B essential modulator; NFkappaB essential modulator(NEMO); Q9Y6K9; inhibitor of kappa light polypeptide gene enhancer in B-cells; kinase gamma; anti-IKBKG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
487
Applicable Applications for anti-IKBKG antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of IKK gamma using anti-IKK gamma antibody (MBS178627).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: rat cardiac muscle tissue lysates,lane 2: HEPG2 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IKK gamma antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IKK gamma at approximately 48KD. The expected band size for IKK gamma is at 48KD. )

Western Blot (WB) (Figure 1. Western blot analysis of IKK gamma using anti-IKK gamma antibody (MBS178627).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: rat cardiac muscle tissue lysates,lane 2: HEPG2 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IKK gamma antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IKK gamma at approximately 48KD. The expected band size for IKK gamma is at 48KD. )
Related Product Information for anti-IKBKG antibody
Rabbit IgG polyclonal antibody for NF-kappa-B essential modulator(IKBKG) detection.
Background: NF-kappa-B essential modulator (NEMO), also known as inhibitor of nuclear factor kappa-B kinase subunit gamma (IKK-gamma), is a protein that in humans is encoded by the IKBKG gene. This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome.
References
1. Rothwarf, D. M., Zandi, E., Natoli, G., Karin, M.IKK-gamma is an essential regulatory subunit of the I-kappa-B kinase complex.Nature 395: 297-300, 1998.
2. Yamaoka, S., Courtois, G., Bessia, C., Whiteside, S. T., Weil, R., Agou, F., Kirk, H. E., Kay, R. J., Israel, A.Complementation cloning of NEMO, a component of the I-kappa-B kinase complex essential for NF-kappa-B activation.Cell 93: 1231-1240, 1998.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,953 Da
NCBI Official Full Name
NF-kappa-B essential modulator isoform b
NCBI Official Synonym Full Names
inhibitor of nuclear factor kappa B kinase subunit gamma
NCBI Official Symbol
IKBKG
NCBI Official Synonym Symbols
IP; IP1; IP2; FIP3; IKKG; IPD2; NEMO; FIP-3; Fip3p; IMD33; AMCBX1; IKKAP1; ZC2HC9; IKK-gamma
NCBI Protein Information
NF-kappa-B essential modulator
UniProt Protein Name
NF-kappa-B essential modulator
UniProt Gene Name
IKBKG
UniProt Synonym Gene Names
FIP3; NEMO; NEMO; IKKAP1; I-kappa-B kinase subunit gamma; IKK-gamma; IKKG; IkB kinase subunit gamma

NCBI Description

This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Mar 2016]

Uniprot Description

IKKG: a regulatory subunit of the IKK-signalosome complex. Interacts preferentially with IKK-beta but also able to interact with IKK-alpha, IKAP, TAX, RIP and MAP3K14/NIK. Defects are the cause of familial incontinentia pigmenti type II (IP2).

Protein type: Adaptor/scaffold; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytoplasm; cytosol; IkappaB kinase complex; intracellular; nucleus; spindle pole; ubiquitin ligase complex

Molecular Function: protein binding; protein domain specific binding; protein heterodimerization activity; protein homodimerization activity; signal transducer activity; ubiquitin protein ligase binding

Biological Process: activation of MAPK activity; activation of NF-kappaB transcription factor; apoptosis; establishment of vesicle localization; I-kappaB kinase/NF-kappaB cascade; immune response; inflammatory response; innate immune response; JNK cascade; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of transcription from RNA polymerase II promoter; response to DNA damage stimulus; response to virus; stimulatory C-type lectin receptor signaling pathway; stress-activated MAPK cascade; T cell receptor signaling pathway

Disease: Ectodermal Dysplasia, Anhidrotic, With Immunodeficiency, Osteopetrosis, And Lymphedema; Ectodermal Dysplasia, Hypohidrotic, With Immune Deficiency; Immunodeficiency 33; Immunodeficiency Without Anhidrotic Ectodermal Dysplasia; Incontinentia Pigmenti; Invasive Pneumococcal Disease, Recurrent Isolated, 2

Research Articles on IKBKG

Similar Products

Product Notes

The IKBKG ikbkg (Catalog #AAA178627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-IKK gamma Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IKK gamma can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the IKBKG ikbkg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IKK gamma, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.