Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IGSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateIGSF1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit IGSF1 Polyclonal Antibody | anti-IGSF1 antibody

IGSF1 antibody - middle region

Gene Names
IGSF1; CHTE; p120; IGCD1; IGDC1; INHBP; PGSF2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IGSF1; Polyclonal Antibody; IGSF1 antibody - middle region; anti-IGSF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC
Sequence Length
242
Applicable Applications for anti-IGSF1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IGSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IGSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateIGSF1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-IGSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateIGSF1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-IGSF1 antibody
This is a rabbit polyclonal antibody against IGSF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-227 AB058894.2 1-227 228-250 Y10523.1 173-195 251-1813 BC028312.1 223-1785
Product Categories/Family for anti-IGSF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
immunoglobulin superfamily member 1 isoform 2
NCBI Official Synonym Full Names
immunoglobulin superfamily member 1
NCBI Official Symbol
IGSF1
NCBI Official Synonym Symbols
CHTE; p120; IGCD1; IGDC1; INHBP; PGSF2
NCBI Protein Information
immunoglobulin superfamily member 1
UniProt Protein Name
Immunoglobulin superfamily member 1
UniProt Gene Name
IGSF1
UniProt Synonym Gene Names
IGDC1; KIAA0364; PGSF2; IgSF1; InhBP
UniProt Entry Name
IGSF1_HUMAN

NCBI Description

This gene encodes a member of the immunoglobulin-like domain-containing superfamily. Proteins in this superfamily contain varying numbers of immunoglobulin-like domains and are thought to participate in the regulation of interactions between cells. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2010]

Uniprot Description

IGSF1: Seems to be a coreceptor in inhibin signaling, but seems not to be a high-affinity inhibin receptor. Antagonizes activin A signaling in the presence or absence of inhibin B. Necessary to mediate a specific antagonistic effect of inhibin B on activin-stimulated transcription. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, misc.

Chromosomal Location of Human Ortholog: Xq25

Cellular Component: membrane; integral to membrane; extracellular region

Molecular Function: protein binding; coreceptor activity; receptor activity

Biological Process: regulation of transcription, DNA-dependent; signal transduction

Disease: Hypothyroidism, Central, And Testicular Enlargement

Research Articles on IGSF1

Similar Products

Product Notes

The IGSF1 igsf1 (Catalog #AAA3206537) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGSF1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IGSF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IGSF1 igsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMAIFSIDNL TPEDEGVYIC RTHIQMLPTL WSEPSNPLKL VVAGGCGYGC. It is sometimes possible for the material contained within the vial of "IGSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.