anti-Human IGFBP5 Polyclonal Antibody | anti-IGFBP5 antibody

Anti-IGFBP5 Antibody

Cat. Num. AAA177651

• Gene Names: IGFBP5; IBP5
• Reactivity: Human
• Applications: Western Blot, ELISA
• Purity: Immunogen Affinity Purified
• Synonyms: IGFBP5; Polyclonal Antibody; Anti-IGFBP5 Antibody; Insulin-like growth factor-binding protein 5; IBP 5; IBP-5; IBP5; IBP5_HUMAN; IGF binding protein 5; IGF BP5; IGF-binding protein 5; IGFBP 5; IGFBP-5; Insulin like growth factor binding protein 5; insulin-like growth factor binding protein 5; anti-IGFBP5 antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 272

• Applicable Applications for anti-IGFBP5 antibody: Western Blot (WB), ELISA (EIA)
• Application Notes: ELISA Concentration: 0.1-0.5ug/ml; Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- IGFBP5 Picoband antibody, MBS177651, Western blottingAll lanes: Anti IGFBP5 (MBS177651) at 0.5ug/mlLane 1: U20S Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 23KD )

Related Product Information for anti-IGFBP5 antibody

Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.

Background: Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in 2 human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved to a biologically inactive 21 kDa fragment (1, 2).

References

1. Allander SV, Larsson C, Ehrenborg E, Suwanichkul A, Weber G, Morris SL, Bajalica S, Kiefer MC, Luthman H, Powell DR (May 1994). "Characterization of the chromosomal gene and promoter for human insulin-like growth factor binding protein-5". J Biol Chem 269 (14): 10891-8.  2. Butt, A. J., Dickson, K. A., McDougall, F., Baxter, R. C. Insulin-like growth factor-binding protein-5 inhibits the growth of human breast cancer cells in vitro and in vivo. J. Biol. Chem. 278: 29676-29685, 2003. 

NCBI and Uniprot Product Information

• NCBI GI #: 10834982
• NCBI GeneID: 3488
• NCBI Accession #: NP_000590.1
• NCBI GenBank Nucleotide #: NM_000599.3
• UniProt Accession #: P24593; Q5U0A3
• Molecular Weight: 30,570 Da
• NCBI Official Full Name: insulin-like growth factor-binding protein 5
• NCBI Official Synonym Full Names: insulin like growth factor binding protein 5
• NCBI Official Symbol: IGFBP5
• NCBI Official Synonym Symbols: IBP5
• NCBI Protein Information: insulin-like growth factor-binding protein 5
• UniProt Protein Name: Insulin-like growth factor-binding protein 5
• Protein Family: Insulin-like growth factor-binding protein
• UniProt Gene Name: IGFBP5
• UniProt Synonym Gene Names: IBP5; IBP-5; IGF-binding protein 5; IGFBP-5
• UniProt Entry Name: IBP5_HUMAN

Uniprot Description

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.