anti-Human, Rat IGFBP2 Polyclonal Antibody | anti-IGFBP2 antibody

Anti-IGFBP2 Antibody

Cat. Num. AAA178300

• Gene Names: IGFBP2; IBP2; IGF-BP53
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: IGFBP2; Polyclonal Antibody; Anti-IGFBP2 Antibody; Insulin-like growth factor-binding protein 2; BP 2; BP2; IBP 2; IBP-2; IBP2; IBP2_HUMAN; IGF binding protein 2; IGF BP53; IGF-binding protein 2; IGFBP 2; IGFBP-2; IGFBP53; Insulin like growth factor binding protein 2 36kDa; Insulin like growth factor binding protein 2; Insulin like growth factor-binding protein 2 precursor; insulin-like growth factor binding protein 2; 36kDa; anti-IGFBP2 antibody

• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 328

• Applicable Applications for anti-IGFBP2 antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- IGFBP2 Picoband antibody, MBS178300, Western blottingAll lanes: Anti IGFBP2 (MBS178300) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugPredicted bind size: 35KDObserved bind size: 35KD)

Related Product Information for anti-IGFBP2 antibody

Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2(IGFBP2) detection. Tested with WB in Human;Rat.

Background: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modifications of IGFBPs, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF. Human IGFBP-2 cDNA encodes a 328 amino acid (aa) residue precursor protein with a putative 39 aa residue signal peptide that is processed to generate the 289 aa residue mature protein. IGFBP-2 contains an integrin receptor recognition sequence (RGD sequence) but lacks potential N-linked glycosylation sites. During development, IGFBP-2 is expressed in a number of tissues. The highest expression level is found in the central nervous system. In adults, high expression levels are also detected in the central nervous system and in a number of reproductive tissues. IGFBP-2 binds preferentially to IGF II, exhibiting a 2-10 fold higher affinity for IGF II than for IGF I.

References

1. Chesik D, De Keyser J, Wilczak N (2007). "Insulin-like growth factor binding protein-2 as a regulator of IGF actions in CNS: implications in multiple sclerosis.". Cytokine Growth Factor Rev. 18 (3-4): 267-78. 2. Wolf E, Lahm H, Wu M et al. (2000). "Effects of IGFBP-2 overexpression in vitro and in vivo.".Pediatr. Nephrol. 14 (7): 572-8. 3. Zapf J, Kiefer M, Merryweather J, Musiarz F, Bauer D, Born W, Fischer JA, Froesch ER (Oct 1990). "Isolation from adult human serum of four insulin-like growth factor (IGF) binding proteins and molecular cloning of one of them that is increased by IGF I administration and in extrapancreatic tumor hypoglycemia".J Biol Chem 265 (25): 14892-8.

NCBI and Uniprot Product Information

• NCBI GI #: 55925576
• NCBI GeneID: 3485
• NCBI Accession #: NP_000588.2
• NCBI GenBank Nucleotide #: NM_000597.2
• UniProt Accession #: P18065; Q14619; Q9UCL3
• Molecular Weight: 34,814 Da
• NCBI Official Full Name: insulin-like growth factor-binding protein 2 isoform a
• NCBI Official Synonym Full Names: insulin like growth factor binding protein 2
• NCBI Official Symbol: IGFBP2
• NCBI Official Synonym Symbols: IBP2; IGF-BP53
• NCBI Protein Information: insulin-like growth factor-binding protein 2
• UniProt Protein Name: Insulin-like growth factor-binding protein 2
• Protein Family: Insulin-like growth factor-binding protein
• UniProt Gene Name: IGFBP2
• UniProt Synonym Gene Names: BP2; IBP2; IBP-2; IGF-binding protein 2; IGFBP-2
• UniProt Entry Name: IBP2_HUMAN

NCBI Description

The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

IGFBP2: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Binds IGF2 more than IGF1.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: apical plasma membrane; cytoplasmic vesicle; extracellular region; extracellular space

Molecular Function: insulin-like growth factor I binding; insulin-like growth factor II binding; protein binding; receptor binding

Biological Process: aging; cellular protein metabolic process; cellular response to hormone stimulus; female pregnancy; positive regulation of activated T cell proliferation; regulation of cell growth; regulation of insulin-like growth factor receptor signaling pathway; response to drug; response to estradiol stimulus; response to glucocorticoid stimulus; response to lithium ion; response to mechanical stimulus; response to nutrient; response to retinoic acid; signal transduction