Western Blot (WB)
(Host: RabbitTarget Name: IFT81Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human IFT81 Polyclonal Antibody | anti-IFT81 antibody
IFT81 Antibody - C-terminal region
Gene Names
IFT81; DV1; CDV1; CDV-1; CDV1R; CDV-1R; SRTD19
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IFT81; Polyclonal Antibody; IFT81 Antibody - C-terminal region; anti-IFT81 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDR
Sequence Length
676
Applicable Applications for anti-IFT81 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IFT81
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: IFT81Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: IFT81Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IFT81 antibody
Component of the intraflagellar transport (IFT) complex B: together with IFT74, forms a tubulin-binding module that specifically mediates transport of tubulin within the cilium. Binds tubulin via its CH (calponin-homology)-like region. Required for ciliogenesis.
Product Categories/Family for anti-IFT81 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74 kDa
NCBI Official Full Name
intraflagellar transport protein 81 homolog isoform 1
NCBI Official Synonym Full Names
intraflagellar transport 81
NCBI Official Symbol
IFT81
NCBI Official Synonym Symbols
DV1; CDV1; CDV-1; CDV1R; CDV-1R; SRTD19
NCBI Protein Information
intraflagellar transport protein 81 homolog
UniProt Protein Name
Intraflagellar transport protein 81 homolog
Protein Family
UniProt Gene Name
IFT81
UniProt Synonym Gene Names
CDV1; CDV-1
UniProt Entry Name
IFT81_HUMAN
NCBI Description
The protein encoded by this gene, together with IFT74, forms a tubulin-binding module of intraflagellar transport complex B. This module is involved in transport of tubulin within the cilium, and the encoded protein is required for ciliogenesis. Mutations in this gene are a cause of short-rib polydactyly syndromes. [provided by RefSeq, Dec 2016]
Research Articles on IFT81
Similar Products
Product Notes
The IFT81 ift81 (Catalog #AAA3222041) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFT81 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFT81 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFT81 ift81 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIRESHGPNM KQAKMWRDLE QLMECKKQCF LKQQSQTSIG QVIQEGGEDR. It is sometimes possible for the material contained within the vial of "IFT81, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
