Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IFNK expression in transfected 293T cell line by IFNK polyclonal antibody. Lane 1: IFNK transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human IFNK Polyclonal Antibody | anti-IFNK antibody

IFNK (Interferon kappa, IFN-kappa, UNQ6124/PRO20084, RP11-27J8.1)

Gene Names
IFNK; IFNT1; INFE1; RP11-27J8.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
IFNK; Polyclonal Antibody; IFNK (Interferon kappa; IFN-kappa; UNQ6124/PRO20084; RP11-27J8.1); Anti -IFNK (Interferon kappa; anti-IFNK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IFNK.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDENENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Applicable Applications for anti-IFNK antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human IFNK, aa1-207 (Q9P0W0).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IFNK expression in transfected 293T cell line by IFNK polyclonal antibody. Lane 1: IFNK transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IFNK expression in transfected 293T cell line by IFNK polyclonal antibody. Lane 1: IFNK transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IFNK antibody
May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin.
Product Categories/Family for anti-IFNK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,218 Da
NCBI Official Full Name
interferon kappa
NCBI Official Synonym Full Names
interferon, kappa
NCBI Official Symbol
IFNK
NCBI Official Synonym Symbols
IFNT1; INFE1; RP11-27J8.1
NCBI Protein Information
interferon kappa; IFN-kappa; interferon-like protein
UniProt Protein Name
Interferon kappa
Protein Family
UniProt Gene Name
IFNK
UniProt Synonym Gene Names
IFN-kappa
UniProt Entry Name
IFNK_HUMAN

NCBI Description

This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq, Jul 2008]

Uniprot Description

IFNK: May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon- stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin. Belongs to the alpha/beta interferon family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: -

Cellular Component: extracellular space; extracellular region

Molecular Function: interferon-alpha/beta receptor binding; cytokine activity

Biological Process: B cell proliferation; adaptive immune response; cytokine and chemokine mediated signaling pathway; response to virus; regulation of MHC class I biosynthetic process; natural killer cell activation; humoral immune response; T cell activation during immune response; negative regulation of cell proliferation; response to exogenous dsRNA; regulation of transcription, DNA-dependent; B cell differentiation; positive regulation of innate immune response; natural killer cell activation during immune response; innate immune response; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein

Research Articles on IFNK

Similar Products

Product Notes

The IFNK ifnk (Catalog #AAA643718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNK (Interferon kappa, IFN-kappa, UNQ6124/PRO20084, RP11-27J8.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the IFNK ifnk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSTKPDMIQK CLWLEILMGI FIAGTLSLDC NLLNVHLRRV TWQNLRHLSS MSNSFPVECL RENIAFELPQ EFLQYTQPMK RDIKKAFYEM SLQAFNIFSQ HTFKYWKERH LKQIQIGLDQ QAEYLNQCLE EDENENEDMK EMKENEMKPS EARVPQLSSL ELRRYFHRID NFLKEKKYSD CAWEIVRVEI RRCLYYFYKF TALFRRK. It is sometimes possible for the material contained within the vial of "IFNK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.