Rabbit anti-Human, Rat IFNGR2 Polyclonal Antibody | anti-IFNGR2 antibody
IFNGR2 Polyclonal Antibody
Gene Names
IFNGR2; AF-1; IFGR2; IMD28; IFNGT1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IFNGR2; Polyclonal Antibody; IFNGR2 Polyclonal Antibody; AF-1; IFGR2; IFNGT1; IMD28; anti-IFNGR2 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
Sequence Length
337
Applicable Applications for anti-IFNGR2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human IFNGR2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-IFNGR2 antibody
This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
Product Categories/Family for anti-IFNGR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37kDa
NCBI Official Full Name
interferon gamma receptor 2 isoform 2
NCBI Official Synonym Full Names
interferon gamma receptor 2
NCBI Official Symbol
IFNGR2
NCBI Official Synonym Symbols
AF-1; IFGR2; IMD28; IFNGT1
NCBI Protein Information
interferon gamma receptor 2
UniProt Protein Name
Interferon gamma receptor 2
Protein Family
UniProt Gene Name
IFNGR2
UniProt Synonym Gene Names
IFN-gamma-R-beta
NCBI Description
This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. [provided by RefSeq, Jul 2008]
Uniprot Description
Associates with IFNGR1 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:8124716, PubMed:7673114,PubMed:7615558). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:8124716, PubMed:7673114, PubMed:15356148). Required for signal transduction in contrast to other receptor subunit responsible for ligand binding (PubMed:7673114).
Research Articles on IFNGR2
Similar Products
Product Notes
The IFNGR2 ifngr2 (Catalog #AAA9134230) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNGR2 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFNGR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the IFNGR2 ifngr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DNLKPSRVYC LQVQAQLLWN KSNIFRVGHL SNISCYETMA DASTELQQVI LISVGTFSLL SVLAGACFFL VLKYRGLIKY WFHTPPSIPL QIEEYLKDPT QPILEALDKD SSPKDDVWDS VSIISFPEKE QEDVLQTL. It is sometimes possible for the material contained within the vial of "IFNGR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
