Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IFNGSample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human IFNG Polyclonal Antibody | anti-IFNG antibody

IFNG Antibody - middle region

Gene Names
IFNG; IFG; IFI
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IFNG; Polyclonal Antibody; IFNG Antibody - middle region; anti-IFNG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGK
Sequence Length
166
Applicable Applications for anti-IFNG antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IFNG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IFNGSample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IFNGSample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IFNG antibody
This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
Product Categories/Family for anti-IFNG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
interferon gamma
NCBI Official Synonym Full Names
interferon gamma
NCBI Official Symbol
IFNG
NCBI Official Synonym Symbols
IFG; IFI
NCBI Protein Information
interferon gamma
UniProt Protein Name
Interferon gamma
Protein Family
UniProt Gene Name
IFNG
UniProt Synonym Gene Names
IFN-gamma
UniProt Entry Name
IFNG_HUMAN

NCBI Description

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

Uniprot Description

IFNG: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Homodimer. Released primarily from activated T lymphocytes. Belongs to the type II (or gamma) interferon family.

Protein type: Cytokine; Secreted; Membrane protein, integral; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: interferon-gamma receptor binding; cytokine activity

Biological Process: positive regulation of isotype switching to IgG isotypes; positive regulation of nitric oxide biosynthetic process; positive regulation of osteoclast differentiation; negative regulation of smooth muscle cell proliferation; apoptosis; positive regulation of interleukin-23 production; positive regulation of interleukin-12 production; positive regulation of interleukin-6 biosynthetic process; negative regulation of epithelial cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of killing of cells of another organism; sensory perception of mechanical stimulus; positive regulation of interleukin-1 beta secretion; positive regulation of membrane protein ectodomain proteolysis; cell surface receptor linked signal transduction; positive regulation of MHC class II biosynthetic process; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of T cell proliferation; cell cycle arrest; defense response to virus; regulation of the force of heart contraction; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to drug; neutrophil chemotaxis; positive regulation of synaptic transmission, cholinergic; adaptive immune response; negative regulation of myelination; CD8-positive, alpha-beta T cell differentiation during immune response; unfolded protein response; response to virus; cytokine and chemokine mediated signaling pathway; positive regulation of tumor necrosis factor production; defense response to protozoan; humoral immune response; antigen processing and presentation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of chemokine biosynthetic process; positive regulation of interleukin-12 biosynthetic process; negative regulation of interleukin-17 production; protein import into nucleus, translocation; defense response to bacterium; neutrophil apoptosis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of neuron differentiation; cell motility; regulation of insulin secretion

Disease: Hepatitis C Virus, Susceptibility To; Aplastic Anemia; Mycobacterium Tuberculosis, Susceptibility To; Tuberous Sclerosis 2; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on IFNG

Similar Products

Product Notes

The IFNG ifng (Catalog #AAA3221481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNG Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFNG ifng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKFFNSNKKK RDDFEKLTNY SVTDLNVQRK AIHELIQVMA ELSPAAKTGK. It is sometimes possible for the material contained within the vial of "IFNG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.